Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199729_WB11.jpg WB (Western Blot) (TSPAN5 antibody - middle region validated by WB using Jurkat cell lysate at 0.25ug/ml.)

Rabbit TSPAN5 Polyclonal Antibody | anti-TSPAN5 antibody

TSPAN5 antibody - middle region

Gene Names
TSPAN5; NET4; NET-4; TM4SF9; TSPAN-5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TSPAN5, Antibody; TSPAN5 antibody - middle region; anti-TSPAN5 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ
Sequence Length
268
Applicable Applications for anti-TSPAN5 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TSPAN5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(TSPAN5 antibody - middle region validated by WB using Jurkat cell lysate at 0.25ug/ml.)

product-image-AAA199729_WB11.jpg WB (Western Blot) (TSPAN5 antibody - middle region validated by WB using Jurkat cell lysate at 0.25ug/ml.)

WB (Western Blot)

(Host: RabbitTarget Name: TSPAN5Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199729_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: TSPAN5Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA199729_IHC15.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-TSPAN5 antibody
This is a rabbit polyclonal antibody against TSPAN5. It was validated on Western Blot and immunohistochemistry

Target Description: TSPAN5 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
tetraspanin-5
NCBI Official Synonym Full Names
tetraspanin 5
NCBI Official Symbol
TSPAN5
NCBI Official Synonym Symbols
NET4; NET-4; TM4SF9; TSPAN-5
NCBI Protein Information
tetraspanin-5
UniProt Protein Name
Tetraspanin-5
UniProt Gene Name
TSPAN5
UniProt Synonym Gene Names
TM4SF9; Tspan-5
UniProt Entry Name
TSN5_HUMAN

Similar Products

Product Notes

The TSPAN5 tspan5 (Catalog #AAA199729) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TSPAN5 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TSPAN5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TSPAN5 tspan5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASRERCGVPF SCCTKDPAED VINTQCGYDA RQKPEVDQQI VIYTKGCVPQ. It is sometimes possible for the material contained within the vial of "TSPAN5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.