IP (Immunoprecipitation)
(Immunoprecipitation analysis of 200ug extracts of MCF7 cells using 3ug TTC11/FIS1 antibody. Western blot was performed from the immunoprecipitate using TTC11/FIS1 antibody at a dilution of 1:1000.)
Rabbit anti-Human TTC11/FIS1 Polyclonal Antibody | anti-TTC11/FIS1 antibody
TTC11/FIS1 Rabbit pAb
Gene Names
IFNAR2; IFN-R; IFNABR; IFNARB; IFN-alpha-REC
Reactivity
Human
Applications
Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
TTC11/FIS1, Antibody; TTC11/FIS1 Rabbit pAb; FIS1; CGI-135; TTC11; fission; mitochondrial 1; anti-TTC11/FIS1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
LPEVDVELPTMPKDSPQQLELLSGPCERRKSPLQDPFPEEDYSSTEGSGGRITFNVDLNSVFLRVLDDEDSDDLEAPLMLSSHLEEMVDPEDPDNVQSNHLLASGE
Applicable Applications for anti-TTC11/FIS1 antibody
IP (Immunoprecipitation), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-122 of human TTC11/FIS1 (NP_057152.2).
Cellular Location
Mitochondrion outer membrane, Peroxisome membrane, Single-pass membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 200ug extracts of MCF7 cells using 3ug TTC11/FIS1 antibody. Western blot was performed from the immunoprecipitate using TTC11/FIS1 antibody at a dilution of 1:1000.)
IP (Immunoprecipitation)
(Immunoprecipitation analysis of 200ug extracts of MCF7 cells using 3ug TTC11/FIS1 antibody. Western blot was performed from the immunoprecipitate using TTC11/FIS1 antibody at a dilution of 1:1000.)
WB (Western Blot)
(Western blot analysis of extracts of 293T cells, using TTC11/FIS1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
WB (Western Blot)
(Western blot analysis of extracts of 293T cells, using TTC11/FIS1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Related Product Information for anti-TTC11/FIS1 antibody
The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM, Mar 2008]
Product Categories/Family for anti-TTC11/FIS1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
515
NCBI Official Full Name
Interferon alpha/beta receptor 2
NCBI Official Synonym Full Names
interferon (alpha, beta and omega) receptor 2
NCBI Official Symbol
IFNAR2
NCBI Official Synonym Symbols
IFN-R; IFNABR; IFNARB; IFN-alpha-REC
NCBI Protein Information
interferon alpha/beta receptor 2; IFN-R-2; IFN-alpha/beta receptor 2; type I interferon receptor 2; interferon alpha binding protein; human interferon alpha/beta receptor; interferon-alpha/beta receptor beta chain
UniProt Protein Name
Interferon alpha/beta receptor 2
UniProt Gene Name
IFNAR2
UniProt Synonym Gene Names
IFNABR; IFNARB; IFN-R-2; IFN-alpha binding protein; IFN-alpha/beta receptor 2
UniProt Entry Name
INAR2_HUMAN
Similar Products
Product Notes
The TTC11/FIS1 ifnar2 (Catalog #AAA282280) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TTC11/FIS1 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TTC11/FIS1 can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the TTC11/FIS1 ifnar2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LPEVDVELPT MPKDSPQQLE LLSGPCERRK SPLQDPFPEE DYSSTEGSGG RITFNVDLNS VFLRVLDDED SDDLEAPLML SSHLEEMVDP EDPDNVQSNH LLASGE. It is sometimes possible for the material contained within the vial of "TTC11/FIS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.