Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282370_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded mouse testis using Tulp2 Rabbit pAb (AAA282370) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

Rabbit Tulp2 Polyclonal Antibody | anti-Tulp2 antibody

Tulp2 Rabbit pAb

Gene Names
Tulp2; Pdet
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
Tulp2, Antibody; Tulp2 Rabbit pAb; Pdet; anti-Tulp2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Sequence
FQSDSSWGLGVGSPFLQENVPQAHLPSGAHSALVTMSYVADGSGERAPLLSPRGAVYTRGNGPAVRHHLCWLPDSSDSDVEEVTMEDIPVISRPPQTNLANLRRGWLASPGPGISQEEKEEEVGSTDARVEDKTPSPDPDPDPTVNSDGDHGDLAPCKVEENTAQKNTETASGIGDEDREKGEVTESTETNYAPVASKVLQGDDGDASNHNAWNMTCPQPRIPGPRLG
Applicable Applications for anti-Tulp2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Positive Samples
NIH/3T3, PC-3, SKOV3, Rat testis
Cellular Location
cilium, cytoplasm, extracellular region
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 78-305 of mouse Tulp2 (NP_032833.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded mouse testis using Tulp2 Rabbit pAb (AAA282370) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282370_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded mouse testis using Tulp2 Rabbit pAb (AAA282370) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemisry)

(Immunohistochemistry analysis of paraffin-embedded rat testis using Tulp2 Rabbit pAb (AAA282370) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282370_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry analysis of paraffin-embedded rat testis using Tulp2 Rabbit pAb (AAA282370) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using Tulp2 antibody (AAA282370) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 30s.)

product-image-AAA282370_WB13.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using Tulp2 antibody (AAA282370) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 30s.)

WB (Western Blot)

(Western blot analysis of extracts of Rat testis, using Tulp2 antibody (AAA282370) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.)

product-image-AAA282370_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of Rat testis, using Tulp2 antibody (AAA282370) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.)
Related Product Information for anti-Tulp2 antibody
Predicted to enable phosphoric diester hydrolase activity. Predicted to be involved in protein localization to cilium. Predicted to be located in cytoplasm and extracellular region. Predicted to be active in cilium. Is expressed in urogenital ridge. Orthologous to human TULP2 (TUB like protein 2).
Product Categories/Family for anti-Tulp2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,519 Da
NCBI Official Full Name
tubby-related protein 2 isoform 2
NCBI Official Synonym Full Names
tubby-like protein 2
NCBI Official Symbol
Tulp2
NCBI Official Synonym Symbols
Pdet
NCBI Protein Information
tubby-related protein 2
UniProt Protein Name
Tubby-related protein 2
UniProt Gene Name
Tulp2
UniProt Synonym Gene Names
Pdet

Similar Products

Product Notes

The Tulp2 tulp2 (Catalog #AAA282370) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tulp2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Tulp2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the Tulp2 tulp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FQSDSSWGLG VGSPFLQENV PQAHLPSGAH SALVTMSYVA DGSGERAPLL SPRGAVYTRG NGPAVRHHLC WLPDSSDSDV EEVTMEDIPV ISRPPQTNLA NLRRGWLASP GPGISQEEKE EEVGSTDARV EDKTPSPDPD PDPTVNSDGD HGDLAPCKVE ENTAQKNTET ASGIGDEDRE KGEVTESTET NYAPVASKVL QGDDGDASNH NAWNMTCPQP RIPGPRLG. It is sometimes possible for the material contained within the vial of "Tulp2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.