Rabbit TVP23C Polyclonal Antibody | anti-TVP23C antibody
TVP23C Antibody - N-terminal region
Gene Names
TVP23C; FAM18B2
Reactivity
Reacts with: HumanPredicted reactivity: Cow, Dog, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TVP23C, Antibody; TVP23C Antibody - N-terminal region; anti-TVP23C antibody
Host
Rabbit
Reactivity
Reacts with: Human
Predicted reactivity: Cow, Dog, Horse, Human, Rabbit, Rat
Predicted reactivity: Cow, Dog, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FWAVKNVTGRLMVGLRWWNHIDEDGKSHWVFESRKESSQENKTVSEAESR
Sequence Length
276
Applicable Applications for anti-TVP23C antibody
WB (Western Blot)
Homology
Cow: 79%; Dog: 79%; Horse: 86%; Human: 100%; Rabbit: 86%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TVP23C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-TVP23C antibody
This is a rabbit polyclonal antibody against TVP23C. It was validated on Western Blot
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-TVP23C antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
Golgi apparatus membrane protein TVP23 homolog C isoform 2
NCBI Official Synonym Full Names
trans-golgi network vesicle protein 23 homolog C
NCBI Official Symbol
TVP23C
NCBI Official Synonym Symbols
FAM18B2
NCBI Protein Information
Golgi apparatus membrane protein TVP23 homolog C
UniProt Protein Name
Golgi apparatus membrane protein TVP23 homolog C
UniProt Gene Name
TVP23C
UniProt Synonym Gene Names
FAM18B2
Similar Products
Product Notes
The TVP23C tvp23c (Catalog #AAA201437) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TVP23C Antibody - N-terminal region reacts with Reacts with: Human Predicted reactivity: Cow, Dog, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TVP23C can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TVP23C tvp23c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FWAVKNVTGR LMVGLRWWNH IDEDGKSHWV FESRKESSQE NKTVSEAESR. It is sometimes possible for the material contained within the vial of "TVP23C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
