Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198079_WB11.jpg WB (Western Blot) (WB Suggested Anti-PEO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Rabbit TWNK Polyclonal Antibody | anti-TWNK antibody

TWNK Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
TWNK; PEO; PEO1; SCA8; ATXN8; IOSCA; PEOA3; SANDO; TWINL; MTDPS7; PRLTS5; C10orf2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TWNK, Antibody; TWNK Antibody - middle region; anti-TWNK antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GVFRKFATDNNCHVTLVIHPRKEDDDKELQTASIFGSAKASQEADNVLIL
Sequence Length
684
Applicable Applications for anti-TWNK antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PEO1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PEO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

product-image-AAA198079_WB11.jpg WB (Western Blot) (WB Suggested Anti-PEO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: PEO1Sample Type: HelaLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5.0 ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 12%C10orf2 is supported by BioGPS gene expression data to be expressed in Hela)

product-image-AAA198079_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: PEO1Sample Type: HelaLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5.0 ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 12%C10orf2 is supported by BioGPS gene expression data to be expressed in Hela)

WB (Western Blot)

(Host: RabbitTarget Name: C10orf2Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA198079_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: C10orf2Sample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-TWNK antibody
This is a rabbit polyclonal antibody against PEO1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a hexameric DNA helicase which unwinds short stretches of double-stranded DNA in the 5' to 3' direction and, along with mitochondrial single-stranded DNA binding protein and mtDNA polymerase gamma, is thought to play a key role in mtDNA replication. The protein localizes to the mitochondrial matrix and mitochondrial nucleoids. Mutations in this gene cause infantile onset spinocerebellar ataxia (IOSCA) and progressive external ophthalmoplegia (PEO) and are also associated with several mitochondrial depletion syndromes. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product Categories/Family for anti-TWNK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
twinkle protein, mitochondrial isoform A
NCBI Official Synonym Full Names
twinkle mtDNA helicase
NCBI Official Symbol
TWNK
NCBI Official Synonym Symbols
PEO; PEO1; SCA8; ATXN8; IOSCA; PEOA3; SANDO; TWINL; MTDPS7; PRLTS5; C10orf2
NCBI Protein Information
twinkle protein, mitochondrial
UniProt Protein Name
Twinkle protein, mitochondrial
UniProt Gene Name
PEO1
UniProt Synonym Gene Names
C10orf2
UniProt Entry Name
PEO1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TWNK peo1 (Catalog #AAA198079) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TWNK Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TWNK can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TWNK peo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GVFRKFATDN NCHVTLVIHP RKEDDDKELQ TASIFGSAKA SQEADNVLIL. It is sometimes possible for the material contained within the vial of "TWNK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.