Rabbit Txlng Polyclonal Antibody | anti-TXLNG antibody
Txlng antibody - N-terminal region
Gene Names
Txlng; Lrp; Fiat; 4932441K18Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Txlng, Antibody; Txlng antibody - N-terminal region; anti-TXLNG antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KADMVCNSQANDILQHQDPSCGGTTKKHSLEGDEGSDFITKNRNLVSSVF
Sequence Length
524
Applicable Applications for anti-TXLNG antibody
WB (Western Blot)
Homology
Cow: 79%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 92%; Mouse: 100%; Rabbit: 93%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-TXLNG antibody
This is a rabbit polyclonal antibody against 4932441K18Rik. It was validated on Western Blot
Target Description: 4932441K18Rik may be involved in intracellular vesicle traffic.4932441K18Rik inhibits ATF4-mediated transcription, possibly by dimerizing with ATF4 to form inactive dimers that cannot bind DNA.4932441K18Rik may be involved in regulating bone mass density through an ATF4-dependent pathway. 4932441K18Rik may be involved in cell cycle progression.
Target Description: 4932441K18Rik may be involved in intracellular vesicle traffic.4932441K18Rik inhibits ATF4-mediated transcription, possibly by dimerizing with ATF4 to form inactive dimers that cannot bind DNA.4932441K18Rik may be involved in regulating bone mass density through an ATF4-dependent pathway. 4932441K18Rik may be involved in cell cycle progression.
Product Categories/Family for anti-TXLNG antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
gamma-taxilin isoform 1
NCBI Official Synonym Full Names
taxilin gamma
NCBI Official Symbol
Txlng
NCBI Official Synonym Symbols
Lrp; Fiat; 4932441K18Rik
NCBI Protein Information
gamma-taxilin
UniProt Protein Name
Gamma-taxilin
UniProt Gene Name
Txlng
UniProt Synonym Gene Names
Lrg; FIAT
Similar Products
Product Notes
The TXLNG txlng (Catalog #AAA198195) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Txlng antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Txlng can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TXLNG txlng for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KADMVCNSQA NDILQHQDPS CGGTTKKHSL EGDEGSDFIT KNRNLVSSVF. It is sometimes possible for the material contained within the vial of "Txlng, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
