Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201589_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: TYRO3Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TYRO3 Polyclonal Antibody | anti-TYRO3 antibody

TYRO3 Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
TYRO3; BYK; Dtk; RSE; Rek; Sky; Tif; Etk-2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TYRO3, Antibody; TYRO3 Antibody - middle region; anti-TYRO3 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 29% sucrose.
Sequence
Synthetic peptide located within the following region: GLSRKIYSGDYYRQGCASKLPVKWLALESLADNLYTVQSDVWAFGVTMWE
Sequence Length
845
Applicable Applications for anti-TYRO3 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TYRO3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: TYRO3Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

product-image-AAA201589_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: TYRO3Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: TYRO3Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

product-image-AAA201589_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: TYRO3Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Related Product Information for anti-TYRO3 antibody
The gene is part of a 3-member transmembrane receptor kinase receptor family with a processed pseudogene distal on chromosome 15. The encoded protein is activated by the products of the growth arrest-specific gene 6 and protein S genes and is involved in controlling cell survival and proliferation, spermatogenesis, immunoregulation and phagocytosis. The encoded protein has also been identified as a cell entry factor for Ebola and Marburg viruses.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92 kDa
NCBI Official Full Name
tyrosine-protein kinase receptor TYRO3 isoform 1
NCBI Official Synonym Full Names
TYRO3 protein tyrosine kinase
NCBI Official Symbol
TYRO3
NCBI Official Synonym Symbols
BYK; Dtk; RSE; Rek; Sky; Tif; Etk-2
NCBI Protein Information
tyrosine-protein kinase receptor TYRO3

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TYRO3 (Catalog #AAA201589) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TYRO3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TYRO3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TYRO3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLSRKIYSGD YYRQGCASKL PVKWLALESL ADNLYTVQSD VWAFGVTMWE. It is sometimes possible for the material contained within the vial of "TYRO3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.