Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46250_IHC11.jpg IHC (Immunohistochemisry) (Anti- UBE1C Picoband antibody, AAA46250,IHC(P)IHC(P): Rat Testis Tissue)

UBE1C Polyclonal Antibody | anti-UBE1C antibody

Anti-UBE1C Antibody

Average rating 0.0
No ratings yet
Gene Names
UBA3; NAE2; UBE1C; hUBA3
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
UBE1C, Antibody; Anti-UBE1C Antibody; NEDD8-activating enzyme E1 catalytic subunit; DKFZp566J164; EC 6.3.2.; hUba3; MGC22384; NEDD8 activating enzyme E1 catalytic subunit; NEDD8 activating enzyme E1C; Nedd8 activating enzyme hUba3; NEDD8-activating enzyme E1C; uba3; UBA3 ubiquitin activating enzyme E1 homolog; UBA3_HUMAN; UBE1C; Ubiquitin activating enzyme 3; Ubiquitin activating enzyme E1C; Ubiquitin-activating enzyme 3; Ubiquitin-activating enzyme E1C; Ubiquitin-like modifier-activating enzyme 3; ubiquitin-like modifier activating enzyme 3; anti-UBE1C antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
463
Applicable Applications for anti-UBE1C antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human UBE1C (409-448aa KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemisry)

(Anti- UBE1C Picoband antibody, AAA46250,IHC(P)IHC(P): Rat Testis Tissue)

product-image-AAA46250_IHC11.jpg IHC (Immunohistochemisry) (Anti- UBE1C Picoband antibody, AAA46250,IHC(P)IHC(P): Rat Testis Tissue)

IHC (Immunohiostchemistry)

(Anti- UBE1C Picoband antibody, AAA46250,IHC(P)IHC(P): Mouse Testis Tissue)

product-image-AAA46250_IHC13.jpg IHC (Immunohiostchemistry) (Anti- UBE1C Picoband antibody, AAA46250,IHC(P)IHC(P): Mouse Testis Tissue)

WB (Western Blot)

(Anti- UBE1C Picoband antibody, AAA46250, Western blottingAll lanes: Anti UBE1C (AAA46250) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugPredicted bind size: 52KDObserved bind size: 52KD)

product-image-AAA46250_WB15.jpg WB (Western Blot) (Anti- UBE1C Picoband antibody, AAA46250, Western blottingAll lanes: Anti UBE1C (AAA46250) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugPredicted bind size: 52KDObserved bind size: 52KD)
Related Product Information for anti-UBE1C antibody
Description: Rabbit IgG polyclonal antibody for NEDD8-activating enzyme E1 catalytic subunit(UBA3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: NEDD8-activating enzyme E1 catalytic subunit is a protein that in humans is encoded by the UBA3 gene. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, an ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
References
1. "Entrez Gene: UBE1C ubiquitin-activating enzyme E1C (UBA3 homolog, yeast)". 2. Bohnsack, R. N., Haas, A. L. Conservation in the mechanism of Nedd8 activation by the human AppBp1-Uba3 heterodimer. J. Biol. Chem. 278: 26823-26830, 2003. 3. Osaka F, Kawasaki H, Aida N, Saeki M, Chiba T, Kawashima S, Tanaka K, Kato S (August 1998). "A new NEDD8-ligating system for cullin-4A". Genes Dev 12 (15): 2263-8.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,072 Da
NCBI Official Full Name
NEDD8-activating enzyme E1 catalytic subunit isoform 1
NCBI Official Synonym Full Names
ubiquitin like modifier activating enzyme 3
NCBI Official Symbol
UBA3
NCBI Official Synonym Symbols
NAE2; UBE1C; hUBA3
NCBI Protein Information
NEDD8-activating enzyme E1 catalytic subunit
UniProt Protein Name
NEDD8-activating enzyme E1 catalytic subunit
UniProt Gene Name
UBA3
UniProt Synonym Gene Names
UBE1C; Ubiquitin-activating enzyme 3
UniProt Entry Name
UBA3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The UBE1C uba3 (Catalog #AAA46250) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-UBE1C Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UBE1C can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the UBE1C uba3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBE1C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.