Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA225835_IHC11.jpg IHC (Immunohistochemisry) (UBE2J1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

Rabbit anti-Human, Mouse UBE2J1 Polyclonal Antibody | anti-UBE2J1 antibody

UBE2J1 Antibody

Average rating 0.0
No ratings yet
Gene Names
UBE2J1; UBC6; UBC6E; Ubc6p; CGI-76; NCUBE1; HSPC153; HSPC205; NCUBE-1; HSU93243
Reactivity
Human, Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
UBE2J1, Antibody; UBE2J1 Antibody; Rabbit Polyclonal UBE2J1 Antibody; Polyclonal UBE2J1 antibody; Anti-UBE2J1 antibody; HSPC205 antibody; CGI-76 antibody; Ubiquitin-Conjugating Enzyme E2 J1 antibody; Ubc6p antibody; UBEJ1-2 antibody; UBEJ1 2; UBEJ1-2; MGC12555 antibody; HSU93243 antibody; HSPC153 antibody; UBEJ1 2 antibody; Ubc6 Homolog Yeast antibody; NCUBE1 antibody; UBE2J1; anti-UBE2J1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Total IgG Protein A purified
Form/Format
Liquid; in 1x PBS buffer with 0.09% (w/v) Sodium Azide and 2% Sucrose.
Concentration
1 mg/ml (varies by lot)
Sequence Length
318
Applicable Applications for anti-UBE2J1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
UBE2J1 antibody was raised using a synthetic peptide corresponding to a region with amino acids METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPD
Cross-Reactivity
Human,Mouse
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

IHC (Immunohistochemisry)

(UBE2J1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

product-image-AAA225835_IHC11.jpg IHC (Immunohistochemisry) (UBE2J1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

WB (Western Blot)

(UBE2J1 antibody used at 2.5 ug/ml to detect target protein.)

product-image-AAA225835_WB13.jpg WB (Western Blot) (UBE2J1 antibody used at 2.5 ug/ml to detect target protein.)

IHC (Immunohistochemistry)

(UBE2J1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X.)

product-image-AAA225835_IHC15.jpg IHC (Immunohistochemistry) (UBE2J1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X.)
Related Product Information for anti-UBE2J1 antibody
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2J1 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum (ER) and may contribute to quality control ER-associated degradation by the ubiquitin-proteasome system.
Product Categories/Family for anti-UBE2J1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa (MW of target protein)
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 J1
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 J1
NCBI Official Symbol
UBE2J1
NCBI Official Synonym Symbols
UBC6; UBC6E; Ubc6p; CGI-76; NCUBE1; HSPC153; HSPC205; NCUBE-1; HSU93243
NCBI Protein Information
ubiquitin-conjugating enzyme E2 J1
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 J1
UniProt Gene Name
UBE2J1
UniProt Synonym Gene Names
NCUBE1; NCUBE-1; HsUBC6e
UniProt Entry Name
UB2J1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The UBE2J1 ube2j1 (Catalog #AAA225835) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBE2J1 Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2J1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the UBE2J1 ube2j1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBE2J1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.