Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281141_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using UBE2L6 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)

Rabbit UBE2L6 Polyclonal Antibody | anti-UBE2L6 antibody

UBE2L6 Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
UBE2L6; RIG-B; UBCH8
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
UBE2L6, Antibody; UBE2L6 Polyclonal Antibody; RIG-B; UBCH8; anti-UBE2L6 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
AFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS
Sequence Length
153
Applicable Applications for anti-UBE2L6 antibody
WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminues of human UBE2l6 (NP_004214.1).
Calculated MW
10kDa/17kDa
Observed MW
18kDa
Preparation and Storage
Store at -20°C. Avoid freeze / thaw cycles.

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using UBE2L6 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)

product-image-AAA281141_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using UBE2L6 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)
Related Product Information for anti-UBE2L6 antibody
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is highly similar in primary structure to the enzyme encoded by the UBE2L3 gene. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Product Categories/Family for anti-UBE2L6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ubiquitin/ISG15-conjugating enzyme E2 L6 isoform 1
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 L6
NCBI Official Symbol
UBE2L6
NCBI Official Synonym Symbols
RIG-B; UBCH8
NCBI Protein Information
ubiquitin/ISG15-conjugating enzyme E2 L6
UniProt Protein Name
Ubiquitin/ISG15-conjugating enzyme E2 L6
UniProt Gene Name
UBE2L6
UniProt Synonym Gene Names
UBCH8; RIG-B

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The UBE2L6 ube2l6 (Catalog #AAA281141) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBE2L6 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2L6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the UBE2L6 ube2l6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AFNLRISFPP EYPFKPPMIK FTTKIYHPNV DENGQICLPI ISSENWKPCT KTCQVLEALN VLVNRPNIRE PLRMDLADLL TQNPELFRKN AEEFTLRFGV DRPS. It is sometimes possible for the material contained within the vial of "UBE2L6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.