Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46350_IHC13.jpg IHC (Immunohiostchemistry) (Anti- UBE2Q2 Picoband antibody, AAA46350,IHC(P)IHC(P): Human Lung Cancer Tissue)

anti-Human UBE2Q2 Polyclonal Antibody | anti-UBE2Q2 antibody

Anti-UBE2Q2 Antibody

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
UBE2Q2, Antibody; Anti-UBE2Q2 Antibody; Ubiquitin-conjugating enzyme E2 Q2; LOC92912; UB2Q2_HUMAN; UBE2Q2; Ubiquitin carrier protein Q2; Ubiquitin conjugating enzyme E2Q 2; Ubiquitin conjugating enzyme E2Q family member 2; ubiquitin-conjugating enzyme E2Q (putative) 2; Ubiquitin-protein ligase Q2; ubiquitin conjugating enzyme E2Q family member 2; anti-UBE2Q2 antibody
Ordering
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
359
Applicable Applications for anti-UBE2Q2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human UBE2Q2 (83-123aa LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ), different from the related mouse sequence by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Anti- UBE2Q2 Picoband antibody, AAA46350,IHC(P)IHC(P): Human Lung Cancer Tissue)

product-image-AAA46350_IHC13.jpg IHC (Immunohiostchemistry) (Anti- UBE2Q2 Picoband antibody, AAA46350,IHC(P)IHC(P): Human Lung Cancer Tissue)

WB (Western Blot)

(Anti- UBE2Q2 Picoband antibody, AAA46350, Western blottingAll lanes: Anti UBE2Q2 (AAA46350) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: A431 Whole Cell Lysate at 40ugLane 3: MCF-7 Whole Cell Lysate at 40ugLane 4: SW620 Whole Cell Lysate at 40ugPredicted bind size: 50KDObserved bind size: 50KD)

product-image-AAA46350_WB15.jpg WB (Western Blot) (Anti- UBE2Q2 Picoband antibody, AAA46350, Western blottingAll lanes: Anti UBE2Q2 (AAA46350) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: A431 Whole Cell Lysate at 40ugLane 3: MCF-7 Whole Cell Lysate at 40ugLane 4: SW620 Whole Cell Lysate at 40ugPredicted bind size: 50KDObserved bind size: 50KD)
Related Product Information for anti-UBE2Q2 antibody
Description: Rabbit IgG polyclonal antibody for Ubiquitin-conjugating enzyme E2 Q2(UBE2Q2) detection. Tested with WB, IHC-P in Human.

Background: UBE2Q2 is identified as a putative ubiquitin-conjugating enzyme (E2) in a microarray screen for mitotic regulatory proteins. Its gene is mapped to 15q24.2. UBE2Q2 can covalently bind ubiquitin on the active site cysteine within the UBC domain. Inhibition of UBE2Q2 in HeLa cells causes an early mitotic arrest and increases cytotoxicity when the cells are treated with microtubule-inhibiting agents (MIAs). Changes in cell cycle progression and viability are not observed in the absence of MIA treatment, indicating that UBE2Q2 is involved in the response to MIAs rather than performing a more general function in mitosis. Moreover, inhibition of the UBE2Q2 protein causes cells to undergo a prolonged prophase arrest, suggesting that UBE2Q2 normally functions to antagonize an early mitotic checkpoint. Finally, inhibition of UBE2Q2 also sensitizes cells to the cytotoxic effects of MIAs through caspase-mediated apoptosis that is correlated with PARP1 cleavage.
References
1. Banerjee, S., Brooks, W. S., Crawford, D. F. Inactivation of the ubiquitin conjugating enzyme UBE2Q2 causes a prophase arrest and enhanced apoptosis in response to microtubule inhibiting agents. Oncogene 26: 6509-6517, 2007. 2. Crawford, D. F., Piwnica-Worms, H. The G2 DNA damage checkpoint delays expression of genes encoding mitotic regulators. J. Biol. Chem. 276: 37166-37177, 2001. 3. Seghatoleslam, A., Zambrano, A., Millon, R., Ganguli, G., Argentini, M., Cromer, A., Abecassis, J., Wasylyk, B. Analysis of a novel human gene, LOC92912, over-expressed in hypopharyngeal tumours. Biochem. Biophys. Res. Commun. 339: 422-429, 2006.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,699 Da
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 Q2 isoform 2
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 Q2
NCBI Official Symbol
UBE2Q2
NCBI Protein Information
ubiquitin-conjugating enzyme E2 Q2
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 Q2
UniProt Gene Name
UBE2Q2
UniProt Entry Name
UB2Q2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The UBE2Q2 ube2q2 (Catalog #AAA46350) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-UBE2Q2 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2Q2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the UBE2Q2 ube2q2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "UBE2Q2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.