Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201304_WB13.jpg WB (Western Blot) (WB Suggested Anti-UBE2V2 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellUBE2V2 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit UBE2V2 Polyclonal Antibody | anti-UBE2V2 antibody

UBE2V2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
UBE2V2; MMS2; UEV2; EDPF1; UEV-2; DDVIT1; EDAF-1; EDPF-1; DDVit-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UBE2V2, Antibody; UBE2V2 antibody - N-terminal region; anti-UBE2V2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENR
Sequence Length
145
Applicable Applications for anti-UBE2V2 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-UBE2V2 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellUBE2V2 is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA201304_WB13.jpg WB (Western Blot) (WB Suggested Anti-UBE2V2 AntibodyTitration: 1.0 ug/mlPositive Control: 721_B Whole CellUBE2V2 is supported by BioGPS gene expression data to be expressed in 721_B)

WB (Western Blot)

(Lanes:1: 40ng HIS-UBE2D1 protein2: 40ng HIS-UBE2D2 protein3: 40ng HIS-UBE2D3 protein4: 40ng HIS-UBE2D4 protein5: 40ng HIS-UBE2E1 protein6: 40ng HIS-UBE2E2 protein7: 40ng HIS-UBE2E3 protein8: 40ng HIS-UBE2K protein9: 40ng HIS-UBE2L3 protein10: 40ng HIS-UBE2N protein11: 40ng HIS-UBE2V1 protein12: 40ng HIS-UBE2V2 protein.Primary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:50,000Gene Name:UBE2V2Submitted by:Dr Chris Boutell. MRC-UoG Centre for Virus Research (CVR), UK.)

product-image-AAA201304_WB15.jpg WB (Western Blot) (Lanes:1: 40ng HIS-UBE2D1 protein2: 40ng HIS-UBE2D2 protein3: 40ng HIS-UBE2D3 protein4: 40ng HIS-UBE2D4 protein5: 40ng HIS-UBE2E1 protein6: 40ng HIS-UBE2E2 protein7: 40ng HIS-UBE2E3 protein8: 40ng HIS-UBE2K protein9: 40ng HIS-UBE2L3 protein10: 40ng HIS-UBE2N protein11: 40ng HIS-UBE2V1 protein12: 40ng HIS-UBE2V2 protein.Primary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:50,000Gene Name:UBE2V2Submitted by:Dr Chris Boutell. MRC-UoG Centre for Virus Research (CVR), UK.)
Related Product Information for anti-UBE2V2 antibody
This is a rabbit polyclonal antibody against UBE2V2. It was validated on Western Blot

Target Description: Ubiquitin-conjugating enzyme E2 variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene also shares homology with ubiquitin-conjugating enzyme E2 variant 1 and yeast MMS2 gene product. It may be involved in the differentiation of monocytes and enterocytes.
Product Categories/Family for anti-UBE2V2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 variant 2
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 V2
NCBI Official Symbol
UBE2V2
NCBI Official Synonym Symbols
MMS2; UEV2; EDPF1; UEV-2; DDVIT1; EDAF-1; EDPF-1; DDVit-1
NCBI Protein Information
ubiquitin-conjugating enzyme E2 variant 2
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 variant 2
UniProt Gene Name
UBE2V2
UniProt Synonym Gene Names
MMS2; UEV2; EDAF-1; EDPF-1
UniProt Entry Name
UB2V2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The UBE2V2 ube2v2 (Catalog #AAA201304) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBE2V2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2V2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the UBE2V2 ube2v2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NFRLLEELEE GQKGVGDGTV SWGLEDDEDM TLTRWTGMII GPPRTNYENR. It is sometimes possible for the material contained within the vial of "UBE2V2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.