Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer and 0.09% sodium azide.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: STTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREEGFR
Sequence Length
309
Applicable Applications for anti-UCP2 antibody
WB (Western Blot)
Protein Size (# AA)
309 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human UCP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-UCP2 antibody
Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed in many tissues, with the greatest expression in skeletal muscle. It is thought to play a role in nonshivering thermogenesis, obesity and diabetes. Chromosomal order is 5'-UCP3-UCP2-3'.
Product Categories/Family for anti-UCP2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33 kDa
NCBI Official Full Name
mitochondrial uncoupling protein 2
NCBI Official Synonym Full Names
uncoupling protein 2
NCBI Official Symbol
UCP2
NCBI Official Synonym Symbols
UCPH; BMIQ4; SLC25A8
NCBI Protein Information
mitochondrial uncoupling protein 2
UniProt Protein Name
Mitochondrial uncoupling protein 2
UniProt Gene Name
UCP2
UniProt Synonym Gene Names
SLC25A8; UCP 2
UniProt Entry Name
UCP2_HUMAN
Similar Products
Product Notes
The UCP2 ucp2 (Catalog #AAA201587) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UCP2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UCP2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the UCP2 ucp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: STTGALAVAV AQPTDVVKVR FQAQARAGGG RRYQSTVNAY KTIAREEGFR. It is sometimes possible for the material contained within the vial of "UCP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
