Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281752_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of mouse liver using UGT1A6 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit UGT1A6 Polyclonal Antibody | anti-UGT1A6 antibody

UGT1A6 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
UGT1A6; GNT1; UGT1; HLUGP; UDPGT; UGT1F; HLUGP1; UGT1A6S; UDPGT 1-6
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
UGT1A6, Antibody; UGT1A6 Rabbit pAb; UGT1A6; GNT1; HLUGP; HLUGP1; UDPGT; UDPGT 1-6; UGT1; UGT1A6S; UGT1F; UDPGT1-6; anti-UGT1A6 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
LLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLYFINCQSLLQDRDTLNFFKESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEHTFSRSPDPVSYIPRCYTKFSDHMTFSQRVANFLVNLLEPYLFYCLFSKYEELASAVLKRDVDIITLYQKVSVWLLRYDFVLEYPRPVMPN
Applicable Applications for anti-UGT1A6 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 65-270 of human UGT1A6 (NP_001063.2).
Cellular Location
Endoplasmic reticulum membrane, Microsome, Single-pass membrane protein
Positive Samples
A-431, HT-29, Mouse liver, Mouse kidney
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of mouse liver using UGT1A6 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281752_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of mouse liver using UGT1A6 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of rat liver using UGT1A6 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281752_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of rat liver using UGT1A6 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using UGT1A6 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA281752_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using UGT1A6 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-UGT1A6 antibody
Background: This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenolic and planar compounds. Alternative splicing in the unique 5' end of this gene results in two transcript variants.
Product Categories/Family for anti-UGT1A6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,528 Da
NCBI Official Full Name
UDP-glucuronosyltransferase 1-6 isoform 1
NCBI Official Synonym Full Names
UDP glucuronosyltransferase 1 family, polypeptide A6
NCBI Official Symbol
UGT1A6
NCBI Official Synonym Symbols
GNT1; UGT1; HLUGP; UDPGT; UGT1F; HLUGP1; UGT1A6S; UDPGT 1-6
NCBI Protein Information
UDP-glucuronosyltransferase 1-6; UDP glycosyltransferase 1 family, polypeptide A6; UDP-glucuronosyltransferase 1 family polypeptide A6s; UDP-glucuronosyltransferase 1-F; UDP-glucuronosyltransferase 1A6; UGT-1F; UGT1*6; UGT1-06; phenol-metabolizing UDP-glu
UniProt Protein Name
UDP-glucuronosyltransferase 1-6
UniProt Gene Name
UGT1A6
UniProt Synonym Gene Names
GNT1; UGT1; UDPGT 1-6; UGT1*6; UGT1-06; UGT1.6; UGT-1F; UGT1F
UniProt Entry Name
UD16_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The UGT1A6 ugt1a6 (Catalog #AAA281752) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UGT1A6 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UGT1A6 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the UGT1A6 ugt1a6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LLLKESKYYT RKIYPVPYDQ EELKNRYQSF GNNHFAERSF LTAPQTEYRN NMIVIGLYFI NCQSLLQDRD TLNFFKESKF DALFTDPALP CGVILAEYLG LPSVYLFRGF PCSLEHTFSR SPDPVSYIPR CYTKFSDHMT FSQRVANFLV NLLEPYLFYC LFSKYEELAS AVLKRDVDII TLYQKVSVWL LRYDFVLEYP RPVMPN. It is sometimes possible for the material contained within the vial of "UGT1A6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.