Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201535_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: UIMC1Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human UIMC1 Polyclonal Antibody | anti-UIMC1 antibody

UIMC1 Antibody - middle region

Gene Names
UIMC1; RAP80; X2HRIP110
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
UIMC1, Antibody; UIMC1 Antibody - middle region; anti-UIMC1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GEQASEKNECISEDMGDEDKEERQESRASDWHSKTKDFQESSIKSLKEKL
Sequence Length
719
Applicable Applications for anti-UIMC1 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human UIMC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: UIMC1Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201535_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: UIMC1Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: UIMC1Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201535_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: UIMC1Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: UIMC1Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201535_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: UIMC1Sample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-UIMC1 antibody
This is a rabbit polyclonal antibody against UIMC1. It was validated on Western Blot

Target Description: UIMC1 is a ubiquitin-binding protein that specifically recognizes and binds 'Lys-63'-linked ubiquitin. It plays a central role in the BRCA1-A complex by specifically binding 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. It also weakly binds monoubiquitin but with much less affinity than 'Lys-63'-linked ubiquitin. It may interact with monoubiquitinated histones H2A and H2B; the relevance of such results is however unclear in vivo. Does not bind Lys-48'-linked ubiquitin. And it may indirectly act as a transcriptional repressor by inhibiting the interaction of NR6A1 with the corepressor NCOR1.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
79kDa
NCBI Official Full Name
BRCA1-A complex subunit RAP80
NCBI Official Synonym Full Names
ubiquitin interaction motif containing 1
NCBI Official Symbol
UIMC1
NCBI Official Synonym Symbols
RAP80; X2HRIP110
NCBI Protein Information
BRCA1-A complex subunit RAP80
UniProt Protein Name
BRCA1-A complex subunit RAP80
UniProt Gene Name
UIMC1
UniProt Synonym Gene Names
RAP80; RXRIP110
UniProt Entry Name
UIMC1_HUMAN

Similar Products

Product Notes

The UIMC1 uimc1 (Catalog #AAA201535) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UIMC1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's UIMC1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the UIMC1 uimc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GEQASEKNEC ISEDMGDEDK EERQESRASD WHSKTKDFQE SSIKSLKEKL. It is sometimes possible for the material contained within the vial of "UIMC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.