Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23598_WB8.jpg WB (Western Blot) (WB Suggested Anti-UQCRQ AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)

Rabbit UQCRQ Polyclonal Antibody | anti-UQCRQ antibody

UQCRQ Antibody - middle region

Gene Names
UQCRQ; QPC; QCR8; QP-C; UQCR7; MC3DN4
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UQCRQ, Antibody; UQCRQ Antibody - middle region; anti-UQCRQ antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK
Sequence Length
93
Applicable Applications for anti-UQCRQ antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human UQCRQ
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-UQCRQ AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)

product-image-AAA23598_WB8.jpg WB (Western Blot) (WB Suggested Anti-UQCRQ AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)

WB (Western Blot)

(Host: RabbitTarget Name: UQCRQSample Type: Human MCF7Antibody Dilution: 1.0ug/mlUQCRQ is supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA23598_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: UQCRQSample Type: Human MCF7Antibody Dilution: 1.0ug/mlUQCRQ is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: UQCRQSample Type: Human HelaAntibody Dilution: 1.0ug/mlUQCRQ is supported by BioGPS gene expression data to be expressed in HeLa)

product-image-AAA23598_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: UQCRQSample Type: Human HelaAntibody Dilution: 1.0ug/mlUQCRQ is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: UQCRQSample Type: Human Fetal KidneyAntibody Dilution: 1.0ug/ml)

product-image-AAA23598_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: UQCRQSample Type: Human Fetal KidneyAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: UQCRQSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23598_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: UQCRQSample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: UQCRQSample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA23598_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: UQCRQSample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: UQCRQSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA23598_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: UQCRQSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: UQCRQSample Type: Human 721_BAntibody Dilution: 1.0ug/mlUQCRQ is supported by BioGPS gene expression data to be expressed in 721_B)

product-image-AAA23598_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: UQCRQSample Type: Human 721_BAntibody Dilution: 1.0ug/mlUQCRQ is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-UQCRQ antibody
This is a rabbit polyclonal antibody against UQCRQ. It was validated on Western Blot

Target Description: This gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain.
Product Categories/Family for anti-UQCRQ antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
cytochrome b-c1 complex subunit 8
NCBI Official Synonym Full Names
ubiquinol-cytochrome c reductase complex III subunit VII
NCBI Official Symbol
UQCRQ
NCBI Official Synonym Symbols
QPC; QCR8; QP-C; UQCR7; MC3DN4
NCBI Protein Information
cytochrome b-c1 complex subunit 8
UniProt Protein Name
Cytochrome b-c1 complex subunit 8
UniProt Gene Name
UQCRQ
UniProt Entry Name
QCR8_HUMAN

Similar Products

Product Notes

The UQCRQ uqcrq (Catalog #AAA23598) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UQCRQ Antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's UQCRQ can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UQCRQ uqcrq for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KGIPNVLRRI RESFFRVVPQ FVVFYLIYTW GTEEFERSKR KNPAAYENDK. It is sometimes possible for the material contained within the vial of "UQCRQ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.