Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281616_IF11.jpg IF (Immunofluorescence) (Confocal immunofluorescence analysis of Hela cells using USO1 antibody at dilution of 1:200. Blue: DAPI for nuclear staining.)

Rabbit anti-Human, Rat USO1 Polyclonal Antibody | anti-USO1 antibody

USO1 Rabbit pAb

Gene Names
USO1; TAP; VDP; P115
Reactivity
Human, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
USO1, Antibody; USO1 Rabbit pAb; USO1; P115; TAP; VDP; anti-USO1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
DLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLDHI
Applicable Applications for anti-USO1 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 663-962 of human USO1 (NP_003706.2).
Cellular Location
Cytoplasm, Golgi apparatus membrane, Peripheral membrane protein, cytosol
Positive Samples
U-87MG, Raji, SGC7901
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Confocal immunofluorescence analysis of Hela cells using USO1 antibody at dilution of 1:200. Blue: DAPI for nuclear staining.)

product-image-AAA281616_IF11.jpg IF (Immunofluorescence) (Confocal immunofluorescence analysis of Hela cells using USO1 antibody at dilution of 1:200. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using USO1 antibody at dilution of 1:200 (60x lens). Blue: DAPI for nuclear staining.)

product-image-AAA281616_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using USO1 antibody at dilution of 1:200 (60x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using USO1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

product-image-AAA281616_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using USO1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-USO1 antibody
Background: The protein encoded by this gene is a peripheral membrane protein which recycles between the cytosol and the Golgi apparatus during interphase. It is regulated by phosphorylation: dephosphorylated protein associates with the Golgi membrane and dissociates from the membrane upon phosphorylation. Ras-associated protein 1 recruits this protein to coat protein complex II (COPII) vesicles during budding from the endoplasmic reticulum, where it interacts with a set of COPII vesicle-associated SNAREs to form a cis-SNARE complex that promotes targeting to the Golgi apparatus. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-USO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
962
NCBI Official Full Name
General vesicular transport factor p115
NCBI Official Synonym Full Names
USO1 vesicle transport factor
NCBI Official Symbol
USO1
NCBI Official Synonym Symbols
TAP; VDP; P115
NCBI Protein Information
general vesicular transport factor p115; vesicle docking protein p115; transcytosis associated protein; USO1 vesicle docking protein homolog
UniProt Protein Name
General vesicular transport factor p115
UniProt Gene Name
USO1
UniProt Synonym Gene Names
VDP; TAP
UniProt Entry Name
USO1_HUMAN

Similar Products

Product Notes

The USO1 uso1 (Catalog #AAA281616) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The USO1 Rabbit pAb reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's USO1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the USO1 uso1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DLQLEELRQQ VSTLKCQNEQ LQTAVTQQVS QIQQHKDQYN LLKIQLGKDN QHQGSYSEGA QMNGIQPEEI GRLREEIEEL KRNQELLQSQ LTEKDSMIEN MKSSQTSGTN EQSSAIVSAR DSEQVAELKQ ELATLKSQLN SQSVEITKLQ TEKQELLQKT EAFAKSVEVQ GETETIIATK TTDVEGRLSA LLQETKELKN EIKALSEERT AIKEQLDSSN STIAILQTEK DKLELEITDS KKEQDDLLVL LADQDQKILS LKNKLKDLGH PVEEEDELES GDQEDEDDES EDPGKDLDHI. It is sometimes possible for the material contained within the vial of "USO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.