Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281690_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using USP18 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit USP18 Polyclonal Antibody | anti-USP18 antibody

USP18 Rabbit pAb

Gene Names
USP18; ISG43; UBP43
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
USP18, Antibody; USP18 Rabbit pAb; USP18; ISG43; UBP43; PTORCH2; anti-USP18 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
DVDSKPLKTLEDALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLDFSQILPMKRESCDAEEQSGG
Applicable Applications for anti-USP18 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human USP18 (NP_059110.2).
Positive Samples
HepG2, RAW264.7
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using USP18 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281690_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using USP18 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using USP18 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281690_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using USP18 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of A431 cells using USP18 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281690_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A431 cells using USP18 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using USP18 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 15s.)

product-image-AAA281690_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using USP18 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 15s.)
Related Product Information for anti-USP18 antibody
Background: The protein encoded by this gene belongs to the ubiquitin-specific proteases (UBP) family of enzymes that cleave ubiquitin from ubiquitinated protein substrates. It is highly expressed in liver and thymus, and is localized to the nucleus. This protein efficiently cleaves only ISG15 (a ubiquitin-like protein) fusions, and deletion of this gene in mice results in a massive increase of ISG15 conjugates in tissues, indicating that this protein is a major ISG15-specific protease. Mice lacking this gene are also hypersensitive to interferon, suggesting a function of this protein in downregulating interferon responses, independent of its isopeptidase activity towards ISG15.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,011 Da
NCBI Official Full Name
ubl carboxyl-terminal hydrolase 18
NCBI Official Synonym Full Names
ubiquitin specific peptidase 18
NCBI Official Symbol
USP18
NCBI Official Synonym Symbols
ISG43; UBP43
NCBI Protein Information
ubl carboxyl-terminal hydrolase 18; hUBP43; ubl thioesterase 18; ubl thiolesterase 18; 43 kDa ISG15-specific protease; ubiquitin specific protease 18; ISG15-specific-processing protease
UniProt Protein Name
Ubl carboxyl-terminal hydrolase 18
UniProt Gene Name
USP18
UniProt Synonym Gene Names
ISG43; hUBP43
UniProt Entry Name
UBP18_HUMAN

Similar Products

Product Notes

The USP18 usp18 (Catalog #AAA281690) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The USP18 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's USP18 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the USP18 usp18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DVDSKPLKTL EDALHCFFQP RELSSKSKCF CENCGKKTRG KQVLKLTHLP QTLTIHLMRF SIRNSQTRKI CHSLYFPQSL DFSQILPMKR ESCDAEEQSG G. It is sometimes possible for the material contained within the vial of "USP18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.