Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200925_WB11.jpg WB (Western Blot) (WB Suggested Anti-USP9X Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysateUSP9X is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Rabbit USP9X Polyclonal Antibody | anti-USP9X antibody

USP9X antibody - C-terminal region

Gene Names
USP9X; FAF; FAM; DFFRX; MRX99; MRXS99F
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
USP9X, Antibody; USP9X antibody - C-terminal region; anti-USP9X antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SQYQQNNHVHGQPYTGPAAHHMNNPQRTGQRAQENYEGSEEVSPPQTKDQ
Sequence Length
2570
Applicable Applications for anti-USP9X antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human USP9X
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-USP9X Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysateUSP9X is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

product-image-AAA200925_WB11.jpg WB (Western Blot) (WB Suggested Anti-USP9X Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysateUSP9X is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

WB (Western Blot)

(Sample Type: 1. total HeLa cell extract (100ug)2. total HeLa cell extract incubated with HA-UbVME (100ug)3. Rat Liver cytosolic extract (100ug)4. Rat Liver cytosolic extract incubated with HA-UbVME (100ug)Primary Dilution: 1:1000Secondary Antibody: alkaline phosphatase-conjugated anti-rabbitSecondary Dilution: 1:1000Image Submitted by: Andreia CarvalhoIBMC-OBF, Portugal)

product-image-AAA200925_WB13.jpg WB (Western Blot) (Sample Type: 1. total HeLa cell extract (100ug)2. total HeLa cell extract incubated with HA-UbVME (100ug)3. Rat Liver cytosolic extract (100ug)4. Rat Liver cytosolic extract incubated with HA-UbVME (100ug)Primary Dilution: 1:1000Secondary Antibody: alkaline phosphatase-conjugated anti-rabbitSecondary Dilution: 1:1000Image Submitted by: Andreia CarvalhoIBMC-OBF, Portugal)

IHC (Immunohistochemistry)

(mouse 3T3 s)

product-image-AAA200925_IHC15.jpg IHC (Immunohistochemistry) (mouse 3T3 s)
Related Product Information for anti-USP9X antibody
This is a rabbit polyclonal antibody against USP9X. It was validated on Western Blot

Target Description: This gene is a member of the peptidase C19 family and encodes a protein that is similar to ubiquitin-specific proteases. Though this gene is located on the X chromosome, it escapes X-inactivation. Mutations in this gene have been associated with Turner syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product Categories/Family for anti-USP9X antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
292kDa
NCBI Official Full Name
probable ubiquitin carboxyl-terminal hydrolase FAF-X isoform 3
NCBI Official Synonym Full Names
ubiquitin specific peptidase 9 X-linked
NCBI Official Symbol
USP9X
NCBI Official Synonym Symbols
FAF; FAM; DFFRX; MRX99; MRXS99F
NCBI Protein Information
probable ubiquitin carboxyl-terminal hydrolase FAF-X
UniProt Protein Name
Probable ubiquitin carboxyl-terminal hydrolase FAF-X
UniProt Gene Name
USP9X
UniProt Synonym Gene Names
DFFRX; FAM; USP9; hFAM
UniProt Entry Name
USP9X_HUMAN

Similar Products

Product Notes

The USP9X usp9x (Catalog #AAA200925) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The USP9X antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's USP9X can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the USP9X usp9x for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SQYQQNNHVH GQPYTGPAAH HMNNPQRTGQ RAQENYEGSE EVSPPQTKDQ. It is sometimes possible for the material contained within the vial of "USP9X, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.