WB (Western Blot)
(WB Suggested Anti-UTP18 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateUTP18 is supported by BioGPS gene expression data to be expressed in Jurkat)
Rabbit UTP18 Polyclonal Antibody | anti-UTP18 antibody
UTP18 antibody - N-terminal region
Gene Names
UTP18; WDR50; CGI-48
Reactivity
Dog, Human, Pig, Rabbit
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
UTP18, Antibody; UTP18 antibody - N-terminal region; anti-UTP18 antibody
Host
Rabbit
Reactivity
Dog, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PARPSAAAAAIAVAAAEEERRLRQRNRLRLEEDKPAVERCLEELVFGDVE
Sequence Length
556
Applicable Applications for anti-UTP18 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 93%; Human: 100%; Pig: 86%; Rabbit: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human UTP18
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-UTP18 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateUTP18 is supported by BioGPS gene expression data to be expressed in Jurkat)
WB (Western Blot)
(WB Suggested Anti-UTP18 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateUTP18 is supported by BioGPS gene expression data to be expressed in Jurkat)
IHC (Immunohistochemistry)
(Rabbit Anti-UTP18 antibodyParaffin Embedded Tissue: Human Lung cell Cellular Data: alveolar cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-UTP18 antibodyParaffin Embedded Tissue: Human Lung cell Cellular Data: alveolar cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-UTP18 antibody
This is a rabbit polyclonal antibody against UTP18. It was validated on Western Blot
Target Description: UTP18 is involved in nucleolar processing of pre-18S ribosomal RNA.
Target Description: UTP18 is involved in nucleolar processing of pre-18S ribosomal RNA.
Product Categories/Family for anti-UTP18 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
U3 small nucleolar RNA-associated protein 18 homolog
NCBI Official Synonym Full Names
UTP18 small subunit processome component
NCBI Official Symbol
UTP18
NCBI Official Synonym Symbols
WDR50; CGI-48
NCBI Protein Information
U3 small nucleolar RNA-associated protein 18 homolog
UniProt Protein Name
U3 small nucleolar RNA-associated protein 18 homolog
UniProt Gene Name
UTP18
UniProt Synonym Gene Names
WDR50
UniProt Entry Name
UTP18_HUMAN
Similar Products
Product Notes
The UTP18 utp18 (Catalog #AAA198766) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UTP18 antibody - N-terminal region reacts with Dog, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's UTP18 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the UTP18 utp18 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PARPSAAAAA IAVAAAEEER RLRQRNRLRL EEDKPAVERC LEELVFGDVE. It is sometimes possible for the material contained within the vial of "UTP18, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.