Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201568_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: VANGL2Sample Tissue: Human Lymph Node TumorAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human VANGL2 Polyclonal Antibody | anti-VANGL2 antibody

VANGL2 Antibody - N-terminal region

Gene Names
VANGL2; LPP1; LTAP; STB1; STBM; STBM1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
VANGL2, Antibody; VANGL2 Antibody - N-terminal region; anti-VANGL2 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSRKHRDRRDRHRSKSRDGGRGDKSVTIQAPGEPLLDNESTRGDERDDNW
Sequence Length
521
Applicable Applications for anti-VANGL2 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human VANGL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: VANGL2Sample Tissue: Human Lymph Node TumorAntibody Dilution: 1.0ug/ml)

product-image-AAA201568_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: VANGL2Sample Tissue: Human Lymph Node TumorAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: VANGL2Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

product-image-AAA201568_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: VANGL2Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Related Product Information for anti-VANGL2 antibody
The protein encoded by this gene is a membrane protein involved in the regulation of planar cell polarity, especially in the stereociliary bundles of the cochlea. The encoded protein transmits directional signals to individual cells or groups of cells in epithelial sheets. This protein is also involved in the development of the neural plate.
Product Categories/Family for anti-VANGL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60 kDa
NCBI Official Full Name
vang-like protein 2
NCBI Official Synonym Full Names
VANGL planar cell polarity protein 2
NCBI Official Symbol
VANGL2
NCBI Official Synonym Symbols
LPP1; LTAP; STB1; STBM; STBM1
NCBI Protein Information
vang-like protein 2
UniProt Protein Name
Vang-like protein 2
UniProt Gene Name
VANGL2
UniProt Synonym Gene Names
KIAA1215; STB1
UniProt Entry Name
VANG2_HUMAN

Similar Products

Product Notes

The VANGL2 vangl2 (Catalog #AAA201568) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VANGL2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VANGL2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the VANGL2 vangl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSRKHRDRRD RHRSKSRDGG RGDKSVTIQA PGEPLLDNES TRGDERDDNW. It is sometimes possible for the material contained within the vial of "VANGL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.