Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197142_WB13.jpg WB (Western Blot) (WB Suggested Anti-VDR AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellThere is BioGPS gene expression data showing that VDR is expressed in Jurkat)

Rabbit VDR Polyclonal Antibody | anti-VDR antibody

VDR antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
VDR; NR1I1; PPP1R163
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
VDR, Antibody; VDR antibody - N-terminal region; anti-VDR antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPV
Sequence Length
427
Applicable Applications for anti-VDR antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human VDR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-VDR AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellThere is BioGPS gene expression data showing that VDR is expressed in Jurkat)

product-image-AAA197142_WB13.jpg WB (Western Blot) (WB Suggested Anti-VDR AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellThere is BioGPS gene expression data showing that VDR is expressed in Jurkat)

WB (Western Blot)

(Host: MouseTarget Name: VDRSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)

product-image-AAA197142_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: VDRSample Tissue: Mouse PancreasAntibody Dilution: 1ug/ml)
Related Product Information for anti-VDR antibody
This is a rabbit polyclonal antibody against VDR. It was validated on Western Blot

Target Description: The nuclear hormone receptor for vitamin D3 also functions as a receptor for the secondary bile acid lithocholic acid. The receptor belongs to the family of trans-acting transcriptional regulatory factors and shows sequence similarity to the steroid and thyroid hormone receptors. Downstream targets of this nuclear hormone receptor are principally involved in mineral metabolism though the receptor regulates a variety of other metabolic pathways, such as those involved in the immune response and cancer. Mutations in this gene are associated with type II vitamin D-resistant rickets. A single nucleotide polymorphism in the initiation codon results in an alternate translation start site three codons downstream. Alternative splicing results in multiple transcript variants encoding the same protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
vitamin D3 receptor isoform VDRA
NCBI Official Synonym Full Names
vitamin D receptor
NCBI Official Symbol
VDR
NCBI Official Synonym Symbols
NR1I1; PPP1R163
NCBI Protein Information
vitamin D3 receptor
UniProt Protein Name
Vitamin D3 receptor
UniProt Gene Name
VDR
UniProt Synonym Gene Names
NR1I1; VDR
UniProt Entry Name
VDR_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The VDR vdr (Catalog #AAA197142) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VDR antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's VDR can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the VDR vdr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LKRKEEEALK DSLRPKLSEE QQRIIAILLD AHHKTYDPTY SDFCQFRPPV. It is sometimes possible for the material contained within the vial of "VDR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.