Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201045_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: VEGFASample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human VEGFA Polyclonal Antibody | anti-VEGFA antibody

VEGFA Antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
VEGFA; VPF; VEGF; MVCD1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
VEGFA, Antibody; VEGFA Antibody - C-terminal region; anti-VEGFA antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSL
Sequence Length
327
Applicable Applications for anti-VEGFA antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human VEGFA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: VEGFASample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201045_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: VEGFASample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-VEGFA AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201045_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-VEGFA AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-VEGFA antibody
This is a rabbit polyclonal antibody against VEGFA. It was validated on Western Blot

Target Description: This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
vascular endothelial growth factor A isoform q
NCBI Official Synonym Full Names
vascular endothelial growth factor A
NCBI Official Symbol
VEGFA
NCBI Official Synonym Symbols
VPF; VEGF; MVCD1
NCBI Protein Information
vascular endothelial growth factor A
UniProt Protein Name
Vascular endothelial growth factor A
UniProt Gene Name
VEGFA
UniProt Synonym Gene Names
VEGF; VEGF-A; VPF
UniProt Entry Name
VEGFA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The VEGFA vegfa (Catalog #AAA201045) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VEGFA Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VEGFA can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the VEGFA vegfa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ECRPKKDRAR QEKKSVRGKG KGQKRKRKKS RYKSWSVYVG ARCCLMPWSL. It is sometimes possible for the material contained within the vial of "VEGFA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.