Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA28435_IHC13.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human tonsil (negative control sample) using Villin1 antibody at dilution of 1:50/1:100 (40x lens).)

Rabbit anti-Human Villin1 Polyclonal Antibody | anti-RCN1 antibody

Villin1 Mouse mAb

Gene Names
RCN1; RCN; RCAL; PIG20; HEL-S-84
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity purification
Synonyms
Villin1, Antibody; Villin1 Mouse mAb; D2S1471; VIL; anti-RCN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
KPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL
Applicable Applications for anti-RCN1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
Immunogen
Recombinant protein of human Villin1.
Cellular Location
Cell projection, Cytoplasm, cytoskeleton, filopodium, filopodium tip, lamellipodium, microvillus, ruffle
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Human tonsil (negative control sample) using Villin1 antibody at dilution of 1:50/1:100 (40x lens).)

product-image-AAA28435_IHC13.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human tonsil (negative control sample) using Villin1 antibody at dilution of 1:50/1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using Villin1 antibody at dilution of 1:50/1:100 (40x lens).)

product-image-AAA28435_IHC12.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon carcinoma using Villin1 antibody at dilution of 1:50/1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human appendix using Villin1 antibody at dilution of 1:50/1:100 (40x lens).)

product-image-AAA28435_IHC11.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human appendix using Villin1 antibody at dilution of 1:50/1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Human tonsil (negative control sample) using Villin1 antibody at dilution of 1:1000/1:5000 (40x lens).)

product-image-AAA28435_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human tonsil (negative control sample) using Villin1 antibody at dilution of 1:1000/1:5000 (40x lens).)

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded Human normal pancreas using Villin1 antibody at dilution of 1:1000/1:5000 (40x lens).)

product-image-AAA28435_IHC9.jpg IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded Human normal pancreas using Villin1 antibody at dilution of 1:1000/1:5000 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human appendix using Villin1 antibody at dilution of 1:1000/1:5000 (40x lens).)

product-image-AAA28435_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human appendix using Villin1 antibody at dilution of 1:1000/1:5000 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Human tonsil (negative control sample) using Villin1 Mouse mAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 50 mM Tris/EDTA buffer pH 8.0 before commencing with IHC staining protocol.)

product-image-AAA28435_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human tonsil (negative control sample) using Villin1 Mouse mAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 50 mM Tris/EDTA buffer pH 8.0 before commencing with IHC staining protocol.)

IHC (Immunohistchemistry)

(Immunohistochemistry of paraffin-embedded Human normal pancreas using Villin1 Mouse mAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 50 mM Tris/EDTA buffer pH 8.0 before commencing with IHC staining protocol.)

product-image-AAA28435_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry of paraffin-embedded Human normal pancreas using Villin1 Mouse mAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 50 mM Tris/EDTA buffer pH 8.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using Villin1 Mouse mAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 50 mM Tris/EDTA buffer pH 8.0 before commencing with IHC staining protocol.)

product-image-AAA28435_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon carcinoma using Villin1 Mouse mAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 50 mM Tris/EDTA buffer pH 8.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human appendix using Villin1 Mouse mAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 50 mM Tris/EDTA buffer pH 8.0 before commencing with IHC staining protocol.)

product-image-AAA28435_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human appendix using Villin1 Mouse mAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 50 mM Tris/EDTA buffer pH 8.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded Human tonsil using Villin1 antibody at dilution of 1:1000 (40x lens).)

product-image-AAA28435_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded Human tonsil using Villin1 antibody at dilution of 1:1000 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human appendix using Villin1 antibody at dilution of 1:1000 (40x lens).)

product-image-AAA28435_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human appendix using Villin1 antibody at dilution of 1:1000 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using Villin1 antibody at dilution of 1:1000 (40x lens).)

product-image-AAA28435_IHC.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon carcinoma using Villin1 antibody at dilution of 1:1000 (40x lens).)
Related Product Information for anti-RCN1 antibody
This gene encodes a member of a family of calcium-regulated actin-binding proteins. This protein represents a dominant part of the brush border cytoskeleton which functions in the capping, severing, and bundling of actin filaments. Two mRNAs of 2.7 kb and 3.5 kb have been observed; they result from utilization of alternate poly-adenylation signals present in the terminal exon. [provided by RefSeq, Jul 2008]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,026 Da
NCBI Official Full Name
reticulocalbin-1
NCBI Official Synonym Full Names
reticulocalbin 1, EF-hand calcium binding domain
NCBI Official Symbol
RCN1
NCBI Official Synonym Symbols
RCN; RCAL; PIG20; HEL-S-84
NCBI Protein Information
reticulocalbin-1; epididymis secretory protein Li 84; proliferation-inducing gene 20
UniProt Protein Name
Reticulocalbin-1
UniProt Gene Name
RCN1
UniProt Synonym Gene Names
RCN
UniProt Entry Name
RCN1_HUMAN

Similar Products

Product Notes

The RCN1 rcn1 (Catalog #AAA28435) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Villin1 Mouse mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Villin1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). WB: 1:500-1:2000 IHC: 1:50-1:200. Researchers should empirically determine the suitability of the RCN1 rcn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KPTVRKERVV RPDSELGERP PEDNQSFQYD HEAFLGKEDS KTFDQLTPDE SKERLGKIVD RIDNDGDGFV TTEELKTWIK RVQKRYIFDN VAKVWKDYDR DKDDKISWEE YKQATYGYYL GNPAEFHDSS DHHTFKKMLP RDERRFKAAD LNGDLTATRE EFTAFLHPEE FEHMKEIVVL ETLEDIDKNG DGFVDQDEYI ADMFSHEENG PEPDWVLSER EQFNEFRDLN KDGKLDKDEI RHWILPQDYD HAQAEARHLV YESDKNKDEK LTKEEILENW NMFVGSQATN YGEDLTKNHD EL. It is sometimes possible for the material contained within the vial of "Villin1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.