WB (Western Blot)
(Host: RabbitTarget Name: VtnSample Type: Rat Kidney lysatesAntibody Dilution: 1.0ug/ml)
Rabbit Vtn Polyclonal Antibody | anti-VTN antibody
Vtn Antibody - middle region
Gene Names
Vtn; Vn; Aa1018
Reactivity
RatPredicted: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Vtn, Antibody; Vtn Antibody - middle region; anti-VTN antibody
Host
Rabbit
Reactivity
Rat
Predicted: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EELCSGKPFDAFTDLKNGSLFAFRGEYCYELDETAVRPGYPKLIQDVWGI
Sequence Length
478
Applicable Applications for anti-VTN antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Rat Vtn
Protein Size
478 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: RabbitTarget Name: VtnSample Type: Rat Kidney lysatesAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: VtnSample Type: Rat Kidney lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-VTN antibody
This is a rabbit polyclonal antibody against Vtn. It was validated on Western Blot
Target Description: Vtn may act as a cofactor for plasminogen activator inhibitor 1 (PAI-1) inhibition of thrombin.
Target Description: Vtn may act as a cofactor for plasminogen activator inhibitor 1 (PAI-1) inhibition of thrombin.
Product Categories/Family for anti-VTN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
vitronectin
NCBI Official Synonym Full Names
vitronectin
NCBI Official Symbol
Vtn
NCBI Official Synonym Symbols
Vn; Aa1018
NCBI Protein Information
vitronectin
UniProt Protein Name
Protein Vtn
UniProt Gene Name
Vtn
UniProt Entry Name
Q3KR94_RAT
Similar Products
Product Notes
The VTN vtn (Catalog #AAA198896) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Vtn Antibody - middle region reacts with Rat Predicted: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Vtn can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the VTN vtn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EELCSGKPFD AFTDLKNGSL FAFRGEYCYE LDETAVRPGY PKLIQDVWGI. It is sometimes possible for the material contained within the vial of "Vtn, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.