Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200775_WB11.jpg WB (Western Blot) (WB Suggested Anti-VTN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateVTN is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit anti-Human VTN Polyclonal Antibody | anti-VTN antibody

VTN antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
VTN; VN; V75; VNT
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
VTN, Antibody; VTN antibody - N-terminal region; anti-VTN antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEE
Sequence Length
478
Applicable Applications for anti-VTN antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human VTN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-VTN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateVTN is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA200775_WB11.jpg WB (Western Blot) (WB Suggested Anti-VTN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateVTN is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: VTNSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA200775_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: VTNSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: VTNSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

product-image-AAA200775_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: VTNSample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-VTN antibody
This is a rabbit polyclonal antibody against VTN. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: VTN is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond.The protein encoded by this gene is a member of the pexin family. It is found in serum and tissues and promotes cell adhesion and spreading, inhibits the membrane-damaging effect of the terminal cytolytic complement pathway, and binds to several serpin serine protease inhibitors. It is a secreted protein and exists in either a single chain form or a clipped, two chain form held together by a disulfide bond. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
vitronectin
NCBI Official Synonym Full Names
vitronectin
NCBI Official Symbol
VTN
NCBI Official Synonym Symbols
VN; V75; VNT
NCBI Protein Information
vitronectin
UniProt Protein Name
Vitronectin
UniProt Gene Name
VTN
UniProt Synonym Gene Names
VN
UniProt Entry Name
VTNC_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The VTN vtn (Catalog #AAA200775) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VTN antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VTN can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the VTN vtn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EDEYTVYDDG EEKNNATVHE QVGGPSLTSD LQAQSKGNPE QTPVLKPEEE. It is sometimes possible for the material contained within the vial of "VTN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.