Rabbit WDR31 Polyclonal Antibody | anti-WDR31 antibody
WDR31 Antibody - middle region
Reactivity
Tested: Human (Predicted: Cow, Guinea Pig, Human, Mouse, Rat)
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WDR31, Antibody; WDR31 Antibody - middle region; anti-WDR31 antibody
Host
Rabbit
Reactivity
Tested: Human (Predicted: Cow, Guinea Pig, Human, Mouse, Rat)
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Applicable Applications for anti-WDR31 antibody
WB (Western Blot)
Protein Size (# AA)
366 amino acids
Peptide Sequence
Synthetic peptide located within the following region: MWDLHGSSQPRQQLCGHAMVVTGLAVSPDSSQLCTGSRDNTLLLWDVVTG
Blocking Peptide
For anti-WDR31 (MBS3219026) antibody is Catalog #
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human WDR31
Predicted Homology Based on Immunogen Sequence
Cow: 82%; Guinea Pig: 100%; Human: 100%; Mouse: 79%; Rat: 92%
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-WDR31 antibody
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene but the biological validity of some variants has not been determined.
Product Categories/Family for anti-WDR31 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
WD repeat-containing protein 31 isoform 3
NCBI Official Synonym Full Names
WD repeat domain 31
NCBI Official Symbol
WDR31
NCBI Protein Information
WD repeat-containing protein 31
UniProt Protein Name
WD repeat-containing protein 31
UniProt Gene Name
WDR31
UniProt Entry Name
WDR31_HUMAN
Similar Products
Product Notes
The WDR31 wdr31 (Catalog #AAA201472) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WDR31 Antibody - middle region reacts with Tested: Human (Predicted: Cow, Guinea Pig, Human, Mouse, Rat) and may cross-react with other species as described in the data sheet. AAA Biotech's WDR31 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the WDR31 wdr31 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "WDR31, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
