Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199459_WB11.jpg WB (Western Blot) (WB Suggested Anti-WDR33 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateWDR33 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit WDR33 Polyclonal Antibody | anti-WDR33 antibody

WDR33 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
WDR33; NET14; WDC146
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
WDR33, Antibody; WDR33 antibody - middle region; anti-WDR33 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TKFVRTSTNKVKCPVFVVRWTPEGRRLVTGASSGEFTLWNGLTFNFETIL
Sequence Length
257
Applicable Applications for anti-WDR33 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human WDR33
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-WDR33 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateWDR33 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA199459_WB11.jpg WB (Western Blot) (WB Suggested Anti-WDR33 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateWDR33 is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Lanes:1: SREC pulldown from lysate from 10^6 human 293T cellsPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-Alexa FluorSecondary Antibody Dilution:1:5000Gene Name:WDR33Submitted by:Anonymous)

product-image-AAA199459_WB13.jpg WB (Western Blot) (Lanes:1: SREC pulldown from lysate from 10^6 human 293T cellsPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-Alexa FluorSecondary Antibody Dilution:1:5000Gene Name:WDR33Submitted by:Anonymous)

WB (Western Blot)

(Host: RabbitTarget Name: WDR33Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlWDR33 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA199459_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: WDR33Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlWDR33 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-WDR33 antibody
This is a rabbit polyclonal antibody against WDR33. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: WDR33 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or DNA recombination.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene is highly expressed in testis and the protein is localized to the nucleus. This gene may play important roles in the mechanisms of cytodifferentiation and/or DNA recombination. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
pre-mRNA 3' end processing protein WDR33 isoform 3
NCBI Official Synonym Full Names
WD repeat domain 33
NCBI Official Symbol
WDR33
NCBI Official Synonym Symbols
NET14; WDC146
NCBI Protein Information
pre-mRNA 3' end processing protein WDR33
UniProt Protein Name
Uncharacterized protein
UniProt Gene Name
WDR33
UniProt Entry Name
Q6NUQ0_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The WDR33 wdr33 (Catalog #AAA199459) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WDR33 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's WDR33 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the WDR33 wdr33 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TKFVRTSTNK VKCPVFVVRW TPEGRRLVTG ASSGEFTLWN GLTFNFETIL. It is sometimes possible for the material contained within the vial of "WDR33, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.