Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198863_WB11.jpg WB (Western Blot) (WB Suggested Anti-WDR6 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateWDR6 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit WDR6 Polyclonal Antibody | anti-WDR6 antibody

WDR6 antibody - C-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
WDR6, Antibody; WDR6 antibody - C-terminal region; anti-WDR6 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLE
Sequence Length
484
Applicable Applications for anti-WDR6 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human WDR6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-WDR6 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateWDR6 is supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA198863_WB11.jpg WB (Western Blot) (WB Suggested Anti-WDR6 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysateWDR6 is supported by BioGPS gene expression data to be expressed in Jurkat)

IHC (Immunohiostchemistry)

(Rabbit Anti-WDR6 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198863_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-WDR6 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Alveolar cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Rabbit Anti-WDR6 antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198863_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-WDR6 antibodyParaffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-WDR6 antibody
This is a rabbit polyclonal antibody against WDR6. It was validated on Western Blot and immunohistochemistry

Target Description: WDR6 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
Product Categories/Family for anti-WDR6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
WDR6 protein, partial
NCBI Official Synonym Full Names
WD repeat domain 6
NCBI Official Symbol
WDR6
NCBI Protein Information
WD repeat-containing protein 6

Similar Products

Product Notes

The WDR6 (Catalog #AAA198863) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WDR6 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's WDR6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the WDR6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TPSLTLQAHS CGINSLHTLP TREGHHLVAS GSEDGSLHVF VLAVEMLQLE. It is sometimes possible for the material contained within the vial of "WDR6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.