Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282260_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using [KO Validated] WTAP Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit WTAP Polyclonal Antibody | anti-WTAP antibody

WTAP Rabbit pAb

Gene Names
FH; MCL; LRCC; HLRCC; MCUL1
Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
WTAP, Antibody; WTAP Rabbit pAb; WTAP; Mum2; anti-WTAP antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
FRIEYDTFGELKVPNDKYYGAQTVRSTMNFKIGGVTERMPTPVIKAFGILKRAAAEVNQDYGLDPKIANAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTN
Applicable Applications for anti-WTAP antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Positive Samples
RAW264.7
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 212-355 of human WTAP (NP_004897.2).
Cellular Location
cytoplasm, nuclear membrane, nuclear speck, nucleoplasm, nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using [KO Validated] WTAP Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282260_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using [KO Validated] WTAP Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of PC-12 cells using [KO Validated] WTAP Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282260_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using [KO Validated] WTAP Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] WTAP Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282260_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] WTAP Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using [KO Validated] WTAP Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282260_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using [KO Validated] WTAP Rabbit pAb at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of RAW264.7 cells, using WTAP antibody at 1:400 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)

product-image-AAA282260_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of RAW264.7 cells, using WTAP antibody at 1:400 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)
Related Product Information for anti-WTAP antibody
The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 protein, this protein is localized throughout the nucleoplasm as well as in speckles and partially colocalizes with splicing factors. Alternative splicing of this gene results in several transcript variants encoding three different isoforms.
Product Categories/Family for anti-WTAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,637 Da
NCBI Official Full Name
fumarate hydratase, mitochondrial
NCBI Official Synonym Full Names
fumarate hydratase
NCBI Official Symbol
FH
NCBI Official Synonym Symbols
MCL; LRCC; HLRCC; MCUL1
NCBI Protein Information
fumarate hydratase, mitochondrial; fumarase
UniProt Protein Name
Fumarate hydratase, mitochondrial
UniProt Gene Name
FH
UniProt Synonym Gene Names
Fumarase
UniProt Entry Name
FUMH_HUMAN

Similar Products

Product Notes

The WTAP fh (Catalog #AAA282260) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WTAP Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's WTAP can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the WTAP fh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FRIEYDTFGE LKVPNDKYYG AQTVRSTMNF KIGGVTERMP TPVIKAFGIL KRAAAEVNQD YGLDPKIANA IMKAADEVAE GKLNDHFPLV VWQTGSGTQT N. It is sometimes possible for the material contained within the vial of "WTAP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.