Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199220_WB11.jpg WB (Western Blot) (WB Suggested Anti-WWP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateWWP1 is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit WWP1 Polyclonal Antibody | anti-WWP1 antibody

WWP1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
WWP1; AIP5; Tiul1; hSDRP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
WWP1, Antibody; WWP1 antibody - N-terminal region; anti-WWP1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT
Sequence Length
922
Applicable Applications for anti-WWP1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human WWP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-WWP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateWWP1 is supported by BioGPS gene expression data to be expressed in HEK293T)

product-image-AAA199220_WB11.jpg WB (Western Blot) (WB Suggested Anti-WWP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysateWWP1 is supported by BioGPS gene expression data to be expressed in HEK293T)

WB (Western Blot)

(Host: RabbitTarget Name: WWP1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA199220_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: WWP1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-WWP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Nuclear in pinealocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199220_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-WWP1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Nuclear in pinealocytesPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-WWP1 antibody
This is a rabbit polyclonal antibody against WWP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. WWP1 is a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. WWP1 belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes.WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. This gene encodes a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. The encoded protein belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. Alternative splicing of this gene generates at least 6 transcript variants; however, the full length nature of these transcripts has not been defined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
105kDa
NCBI Official Full Name
NEDD4-like E3 ubiquitin-protein ligase WWP1
NCBI Official Synonym Full Names
WW domain containing E3 ubiquitin protein ligase 1
NCBI Official Symbol
WWP1
NCBI Official Synonym Symbols
AIP5; Tiul1; hSDRP1
NCBI Protein Information
NEDD4-like E3 ubiquitin-protein ligase WWP1
UniProt Protein Name
NEDD4-like E3 ubiquitin-protein ligase WWP1
UniProt Gene Name
WWP1
UniProt Synonym Gene Names
AIP5; Tiul1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The WWP1 wwp1 (Catalog #AAA199220) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WWP1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's WWP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the WWP1 wwp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ATASPRSDTS NNHSGRLQLQ VTVSSAKLKR KKNWFGTAIY TEVVVDGEIT. It is sometimes possible for the material contained within the vial of "WWP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.