Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197726_WB10.jpg WB (Western Blot) (WB Suggested Anti-XRCC5 Antibody Titration: 1.25ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysateXRCC5 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit XRCC5 Polyclonal Antibody | anti-XRCC5 antibody

XRCC5 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
XRCC5; KU80; KUB2; Ku86; NFIV; KARP1; KARP-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
XRCC5, Antibody; XRCC5 antibody - C-terminal region; anti-XRCC5 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDM
Sequence Length
732
Applicable Applications for anti-XRCC5 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human XRCC5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-XRCC5 Antibody Titration: 1.25ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysateXRCC5 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

product-image-AAA197726_WB10.jpg WB (Western Blot) (WB Suggested Anti-XRCC5 Antibody Titration: 1.25ug/mlELISA Titer: 1:12500Positive Control: Jurkat cell lysateXRCC5 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

WB (Western Blot)

(Lanes:1. 30 ug MiaPaca-2 cell lysate2. 30 ug Panc-1 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-Rabbit HRPSecondary Antibody Dilution:1:4000Gene Name:XRCC5Submitted by:Dr. Crissy Dudgeon, Ph.D., CINJ)

product-image-AAA197726_WB11.jpg WB (Western Blot) (Lanes:1. 30 ug MiaPaca-2 cell lysate2. 30 ug Panc-1 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-Rabbit HRPSecondary Antibody Dilution:1:4000Gene Name:XRCC5Submitted by:Dr. Crissy Dudgeon, Ph.D., CINJ)

IHC (Immunohiostchemistry)

(Sample Type :Human lung adenocarcinoma cell line A549Primary Antibody Dilution :1:100Secondary Antibody :Goat anti-rabbit AlexaFluor 488Secondary Antibody Dilution :1:400Color/Signal Descriptions :XRCC5: Green DAPI:BlueGene Name :XRCC5 Submitted by :Dr. Crissy Dudgeon, Ph.D., CINJ)

product-image-AAA197726_IHC13.jpg IHC (Immunohiostchemistry) (Sample Type :Human lung adenocarcinoma cell line A549Primary Antibody Dilution :1:100Secondary Antibody :Goat anti-rabbit AlexaFluor 488Secondary Antibody Dilution :1:400Color/Signal Descriptions :XRCC5: Green DAPI:BlueGene Name :XRCC5 Submitted by :Dr. Crissy Dudgeon, Ph.D., CINJ)

IHC (Immunohistochemistry)

(Human Pancreas)

product-image-AAA197726_IHC15.jpg IHC (Immunohistochemistry) (Human Pancreas)
Related Product Information for anti-XRCC5 antibody
This is a rabbit polyclonal antibody against XRCC5. It was validated on Western Blot and immunohistochemistry

Target Description: XRCC5 encodes the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
X-ray repair cross-complementing protein 5
NCBI Official Synonym Full Names
X-ray repair cross complementing 5
NCBI Official Symbol
XRCC5
NCBI Official Synonym Symbols
KU80; KUB2; Ku86; NFIV; KARP1; KARP-1
NCBI Protein Information
X-ray repair cross-complementing protein 5

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The XRCC5 (Catalog #AAA197726) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The XRCC5 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's XRCC5 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the XRCC5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GITLITKEEA SGSSVTAEEA KKFLAPKDKP SGDTAAVFEE GGDVDDLLDM. It is sometimes possible for the material contained within the vial of "XRCC5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.