Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197286_WB11.jpg WB (Western Blot) (Ywhae antibody - C-terminal region validated by WB using Mouse Kidney lysate at 1.0ug/ml.)

Rabbit Ywhae Polyclonal Antibody | anti-YWHAE antibody

Ywhae antibody - C-terminal region

Gene Names
Ywhae; AU019196
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
Ywhae, Antibody; Ywhae antibody - C-terminal region; anti-YWHAE antibody
Ordering
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDEN
Sequence Length
255
Applicable Applications for anti-YWHAE antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Ywhae antibody - C-terminal region validated by WB using Mouse Kidney lysate at 1.0ug/ml.)

product-image-AAA197286_WB11.jpg WB (Western Blot) (Ywhae antibody - C-terminal region validated by WB using Mouse Kidney lysate at 1.0ug/ml.)

WB (Western Blot)

(Sample Type: Mouse BrainSample Type: 2. mouse brain extracts (80ug)3. rat brain extract (80ug)Primary Antibody Dilution: 2ug/mlSecondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution: 1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science )

product-image-AAA197286_WB13.jpg WB (Western Blot) (Sample Type: Mouse BrainSample Type: 2. mouse brain extracts (80ug)3. rat brain extract (80ug)Primary Antibody Dilution: 2ug/mlSecondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution: 1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science )

IHC (Immunohistochemistry)

(Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :Ywhae: Red DAPI:BlueGene Name :YwhaeSubmitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

product-image-AAA197286_IHC15.jpg IHC (Immunohistochemistry) (Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :Ywhae: Red DAPI:BlueGene Name :YwhaeSubmitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)
Related Product Information for anti-YWHAE antibody
This is a rabbit polyclonal antibody against Ywhae. It was validated on Western Blot

Target Description: YWHAE is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. YWHAE binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. The binding generally results in the modulation of the activity of the binding partner.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
14-3-3 protein epsilon
NCBI Official Synonym Full Names
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide
NCBI Official Symbol
Ywhae
NCBI Official Synonym Symbols
AU019196
NCBI Protein Information
14-3-3 protein epsilon
UniProt Protein Name
14-3-3 protein epsilon
UniProt Gene Name
Ywhae
UniProt Synonym Gene Names
14-3-3E
UniProt Entry Name
1433E_MOUSE

Similar Products

Product Notes

The YWHAE ywhae (Catalog #AAA197286) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ywhae antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Ywhae can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the YWHAE ywhae for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELDTLSEESY KDSTLIMQLL RDNLTLWTSD MQGDGEEQNK EALQDVEDEN. It is sometimes possible for the material contained within the vial of "Ywhae, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.