Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201669_WB11.jpg WB (Western Blot) (WB Suggested Anti-YWHAH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

Rabbit YWHAH Polyclonal Antibody | anti-YWHAH antibody

YWHAH antibody - N-terminal region

Gene Names
YWHAH; YWHA1
Reactivity
Dog, Human, Rabbit, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
YWHAH, Antibody; YWHAH antibody - N-terminal region; anti-YWHAH antibody
Ordering
Host
Rabbit
Reactivity
Dog, Human, Rabbit, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKV
Sequence Length
246
Applicable Applications for anti-YWHAH antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 100%; Human: 100%; Rabbit: 100%; Zebrafish: 78%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human YWHAH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-YWHAH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

product-image-AAA201669_WB11.jpg WB (Western Blot) (WB Suggested Anti-YWHAH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

IHC (Immunohiostchemistry)

(WB Suggested Anti-YWHAH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

product-image-AAA201669_IHC13.jpg IHC (Immunohiostchemistry) (WB Suggested Anti-YWHAH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

IHC (Immunohistochemistry)

(Human Intestine)

product-image-AAA201669_IHC15.jpg IHC (Immunohistochemistry) (Human Intestine)
Related Product Information for anti-YWHAH antibody
This is a rabbit polyclonal antibody against YWHAH. It was validated on Western Blot and immunohistochemistry

Target Description: The YWHAH gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat has been associated with early-onset schizophrenia.This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat has been associated with early-onset schizophrenia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
14-3-3 protein eta
NCBI Official Synonym Full Names
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta
NCBI Official Symbol
YWHAH
NCBI Official Synonym Symbols
YWHA1
NCBI Protein Information
14-3-3 protein eta
UniProt Protein Name
14-3-3 protein eta
UniProt Gene Name
YWHAH
UniProt Synonym Gene Names
YWHA1
UniProt Entry Name
1433F_HUMAN

Similar Products

Product Notes

The YWHAH ywhah (Catalog #AAA201669) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The YWHAH antibody - N-terminal region reacts with Dog, Human, Rabbit, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's YWHAH can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the YWHAH ywhah for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ADGNEKKLEK VKAYREKIEK ELETVCNDVL SLLDKFLIKN CNDFQYESKV. It is sometimes possible for the material contained within the vial of "YWHAH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.