WB (Western Blot)
(WB Suggested Anti-ZBTB32 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: HepG2 cell lysate)
Rabbit ZBTB32 Polyclonal Antibody | anti-ZBTB32 antibody
ZBTB32 antibody - N-terminal region
Gene Names
ZBTB32; Rog; FAXF; FAZF; TZFP; ZNF538
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZBTB32, Antibody; ZBTB32 antibody - N-terminal region; anti-ZBTB32 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQL
Sequence Length
302
Applicable Applications for anti-ZBTB32 antibody
WB (Western Blot)
Homology
Cow: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZBTB32
Conjugation
Unconjugated
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-ZBTB32 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: HepG2 cell lysate)
WB (Western Blot)
(WB Suggested Anti-ZBTB32 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:2500Positive Control: HepG2 cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: ZBTB32Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: ZBTB32Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlZBTB32 is supported by BioGPS gene expression data to be expressed in 721_B)
WB (Western Blot)
(Host: RabbitTarget Name: WT1Sample Type: 721_BAntibody Dilution: 1.0ug/mlZBTB32 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-ZBTB32 antibody
This is a rabbit polyclonal antibody against ZBTB32. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ZBTB32 may play an essential role during the proliferative stages of primitive hematopoietic progenitors, possibly acting in concert with (a subset of) the Fanconi anemia proteins. This gene can also interact with GATA-2 and can modify GATA-2 transactivation capacity.
Target Description: ZBTB32 may play an essential role during the proliferative stages of primitive hematopoietic progenitors, possibly acting in concert with (a subset of) the Fanconi anemia proteins. This gene can also interact with GATA-2 and can modify GATA-2 transactivation capacity.
Product Categories/Family for anti-ZBTB32 antibody
NCBI and Uniprot Product Information
NCBI GeneID
Molecular Weight
33kDa
NCBI Official Full Name
Protein
NCBI Official Synonym Full Names
zinc finger and BTB domain containing 32
NCBI Official Symbol
ZBTB32
NCBI Official Synonym Symbols
Rog; FAXF; FAZF; TZFP; ZNF538
NCBI Protein Information
zinc finger and BTB domain-containing protein 32
Similar Products
Product Notes
The ZBTB32 (Catalog #AAA197235) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZBTB32 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZBTB32 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ZBTB32 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PIRLPSPYGS DRLVQLAARL RPALCDTLIT VGSQEFPAHS LVLAGVSQQL. It is sometimes possible for the material contained within the vial of "ZBTB32, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.