WB (Western Blot)
(WB Suggested Anti-ZFP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Rabbit ZFP1 Polyclonal Antibody | anti-ZFP1 antibody
ZFP1 antibody - N-terminal region
Gene Names
ZFP1; ZNF475
Reactivity
Cow, Dog, Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ZFP1, Antibody; ZFP1 antibody - N-terminal region; anti-ZFP1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SNRSYAGKQTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALSHKAAI
Sequence Length
352
Applicable Applications for anti-ZFP1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 92%; Dog: 86%; Human: 100%; Mouse: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-ZFP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
WB (Western Blot)
(WB Suggested Anti-ZFP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
IHC (Immunohiostchemistry)
(Rabbit Anti-ZFP1 AntibodyParaffin Embedded Tissue: Human SpermatophoreCellular Data: Epithelial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohiostchemistry)
(Rabbit Anti-ZFP1 AntibodyParaffin Embedded Tissue: Human SpermatophoreCellular Data: Epithelial cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-ZFP1 AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-ZFP1 AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-ZFP1 antibody
This is a rabbit polyclonal antibody against ZFP1. It was validated on Western Blot and immunohistochemistry
Target Description: Zinc finger proteins (Zfp) are encoded by a large family of genes present in many organisms including yeast and human. Some of them are transcriptional activators and bind specifically to DNA by zinc mediated folded structures commonly known as zinc fingers. The putative Zfp-1 (Zinc finger protein 1 homolog) protein contains in addition to 7 zinc fingers, two helix-turn-helix motifs.
Target Description: Zinc finger proteins (Zfp) are encoded by a large family of genes present in many organisms including yeast and human. Some of them are transcriptional activators and bind specifically to DNA by zinc mediated folded structures commonly known as zinc fingers. The putative Zfp-1 (Zinc finger protein 1 homolog) protein contains in addition to 7 zinc fingers, two helix-turn-helix motifs.
Product Categories/Family for anti-ZFP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41kDa
NCBI Official Full Name
zinc finger protein 1 homolog isoform 1
NCBI Official Synonym Full Names
ZFP1 zinc finger protein
NCBI Official Symbol
ZFP1
NCBI Official Synonym Symbols
ZNF475
NCBI Protein Information
zinc finger protein 1 homolog
Similar Products
Product Notes
The ZFP1 (Catalog #AAA197190) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZFP1 antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZFP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ZFP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SNRSYAGKQT DECNEFGKAL LYLKQEKTHS GVEYSEYNKS GKALSHKAAI. It is sometimes possible for the material contained within the vial of "ZFP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.