Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198456_WB13.jpg WB (Western Blot) (WB Suggested Anti-Zfr AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)

Rabbit Zfr Polyclonal Antibody | anti-ZFR antibody

Zfr antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
Zfr; C920030H05Rik
Reactivity
Dog, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
Zfr, Antibody; Zfr antibody - N-terminal region; anti-ZFR antibody
Ordering
Host
Rabbit
Reactivity
Dog, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ICPVVSFTYVPSRLGEDAKMATGNYFGFTHSGAAAAAAAAQYSQQPASGV
Sequence Length
1052
Applicable Applications for anti-ZFR antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-Zfr AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)

product-image-AAA198456_WB13.jpg WB (Western Blot) (WB Suggested Anti-Zfr AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)

IHC (Immunohistochemistry)

(Rabbit Anti-Zfr AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA198456_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-Zfr AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-ZFR antibody
This is a rabbit polyclonal antibody against Zfr. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-ZFR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
114kDa
NCBI Official Full Name
zinc finger RNA-binding protein isoform 1
NCBI Official Synonym Full Names
zinc finger RNA binding protein
NCBI Official Symbol
Zfr
NCBI Official Synonym Symbols
C920030H05Rik
NCBI Protein Information
zinc finger RNA-binding protein

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ZFR (Catalog #AAA198456) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Zfr antibody - N-terminal region reacts with Dog, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Zfr can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ZFR for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ICPVVSFTYV PSRLGEDAKM ATGNYFGFTH SGAAAAAAAA QYSQQPASGV. It is sometimes possible for the material contained within the vial of "Zfr, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.