WB (Western Blot)
(Host: RabbitTarget Name: ZMYM6Sample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human ZMYM6 Polyclonal Antibody | anti-ZMYM6 antibody
ZMYM6 Antibody - N-terminal region
Gene Names
ZMYM6; MYM; ZBED7; ZNF258; Buster2; ZNF198L4
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZMYM6, Antibody; ZMYM6 Antibody - N-terminal region; anti-ZMYM6 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QELLDKIKEEPDNAQEYGCVQQPKTQESKLKIGGVSSVNERPIAQQLNPG
Sequence Length
723
Applicable Applications for anti-ZMYM6 antibody
WB (Western Blot)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of HUMAN ZMYM6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: RabbitTarget Name: ZMYM6Sample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: ZMYM6Sample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)
IHC (Immunohistochemistry)
(Rabbit Anti-ZMYM6Formalin Fixed Paraffin Embedded Tissue: Human Adult ProstateObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-ZMYM6Formalin Fixed Paraffin Embedded Tissue: Human Adult ProstateObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-ZMYM6 antibody
This is a rabbit polyclonal antibody against ZMYM6. It was validated on Western Blot
Target Description: ZMYM6 plays a role in the regulation of cell morphology and cytoskeletal organization.
Target Description: ZMYM6 plays a role in the regulation of cell morphology and cytoskeletal organization.
Product Categories/Family for anti-ZMYM6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
79kDa
NCBI Official Full Name
ZMYM6 protein
NCBI Official Synonym Full Names
zinc finger MYM-type containing 6
NCBI Official Symbol
ZMYM6
NCBI Official Synonym Symbols
MYM; ZBED7; ZNF258; Buster2; ZNF198L4
NCBI Protein Information
zinc finger MYM-type protein 6
UniProt Protein Name
Zinc finger MYM-type protein 6
UniProt Gene Name
ZMYM6
UniProt Synonym Gene Names
Buster2; KIAA1353; ZNF258
UniProt Entry Name
ZMYM6_HUMAN
Similar Products
Product Notes
The ZMYM6 zmym6 (Catalog #AAA197893) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZMYM6 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZMYM6 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ZMYM6 zmym6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QELLDKIKEE PDNAQEYGCV QQPKTQESKL KIGGVSSVNE RPIAQQLNPG. It is sometimes possible for the material contained within the vial of "ZMYM6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.