Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198005_WB13.jpg WB (Western Blot) (WB Suggested Anti-ZNF133 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateZNF133 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit ZNF133 Polyclonal Antibody | anti-ZNF133 antibody

ZNF133 antibody - N-terminal region

Gene Names
ZNF133; ZNF150; pHZ-13; pHZ-66
Reactivity
Horse, Human, Mouse, Pig, Rabbit
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Synonyms
ZNF133, Antibody; ZNF133 antibody - N-terminal region; anti-ZNF133 antibody
Ordering
Host
Rabbit
Reactivity
Horse, Human, Mouse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRGVELEASPAQTGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLL
Sequence Length
653
Applicable Applications for anti-ZNF133 antibody
WB (Western Blot), IF (Immunofluorescence)
Homology
Horse: 92%; Human: 100%; Mouse: 83%; Pig: 100%; Rabbit: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF133
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ZNF133 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateZNF133 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA198005_WB13.jpg WB (Western Blot) (WB Suggested Anti-ZNF133 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateZNF133 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

IF (Immunofluorescence)

(WB Suggested Anti-DPYS (dihydropyrimidinase) Antibody (Clone #:8B11)(100ug)Titration: 0.5 ug/mlPositive Control: Fetal Liver)

product-image-AAA198005_IF15.jpg IF (Immunofluorescence) (WB Suggested Anti-DPYS (dihydropyrimidinase) Antibody (Clone #:8B11)(100ug)Titration: 0.5 ug/mlPositive Control: Fetal Liver)
Related Product Information for anti-ZNF133 antibody
This is a rabbit polyclonal antibody against ZNF133. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZNF133 may be involved in transcriptional regulation as a repressor.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
zinc finger protein 133 isoform a
NCBI Official Synonym Full Names
zinc finger protein 133
NCBI Official Symbol
ZNF133
NCBI Official Synonym Symbols
ZNF150; pHZ-13; pHZ-66
NCBI Protein Information
zinc finger protein 133
UniProt Protein Name
Zinc finger protein 133
UniProt Gene Name
ZNF133
UniProt Synonym Gene Names
ZNF150
UniProt Entry Name
ZN133_HUMAN

Similar Products

Product Notes

The ZNF133 znf133 (Catalog #AAA198005) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF133 antibody - N-terminal region reacts with Horse, Human, Mouse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF133 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence). Researchers should empirically determine the suitability of the ZNF133 znf133 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRGVELEASP AQTGNPEETD KLLKRIEVLG FGTVNCGECG LSFSKMTNLL. It is sometimes possible for the material contained within the vial of "ZNF133, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.