Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198406_WB11.jpg WB (Western Blot) (WB Suggested Anti-ZNF185 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Hela cell lysate)

Rabbit ZNF185 Polyclonal Antibody | anti-ZNF185 antibody

ZNF185 antibody - N-terminal region

Gene Names
ZNF185; SCELL
Reactivity
Horse, Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF185, Antibody; ZNF185 antibody - N-terminal region; anti-ZNF185 antibody
Ordering
Host
Rabbit
Reactivity
Horse, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LAPYNIRRSSTSGDTEEEEEEEVVPFSSDEQKRRSEAASGVLRRTAPREH
Sequence Length
689
Applicable Applications for anti-ZNF185 antibody
WB (Western Blot)
Homology
Horse: 79%; Human: 100%; Mouse: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF185
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ZNF185 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Hela cell lysate)

product-image-AAA198406_WB11.jpg WB (Western Blot) (WB Suggested Anti-ZNF185 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Hela cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: ZNF185Sample Type: MCF7Antibody Dilution: 1.0ug/mlZNF185 is supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA198406_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: ZNF185Sample Type: MCF7Antibody Dilution: 1.0ug/mlZNF185 is supported by BioGPS gene expression data to be expressed in MCF7)

WB (Western Blot)

(Host: RabbitTarget Name: ZNF185Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA198406_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: ZNF185Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ZNF185 antibody
This is a rabbit polyclonal antibody against ZNF185. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZNF185 contains 1 LIM zinc-binding domain. The function of ZNF185 remains unknown.ZNF185 encodes a LIM-domain zinc finger protein. These proteins are thought to be involved in protein-protein interactions.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1276 AY997296.1 1-1276 1277-4307 AK056517.1 347-3377 4308-4312 BQ923456.1 628-632
Product Categories/Family for anti-ZNF185 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
zinc finger protein 185 isoform 4
NCBI Official Synonym Full Names
zinc finger protein 185 with LIM domain
NCBI Official Symbol
ZNF185
NCBI Official Synonym Symbols
SCELL
NCBI Protein Information
zinc finger protein 185

Similar Products

Product Notes

The ZNF185 (Catalog #AAA198406) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF185 antibody - N-terminal region reacts with Horse, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF185 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ZNF185 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LAPYNIRRSS TSGDTEEEEE EEVVPFSSDE QKRRSEAASG VLRRTAPREH. It is sometimes possible for the material contained within the vial of "ZNF185, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.