Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198404_WB13.jpg WB (Western Blot) (WB Suggested Anti-ZNF197 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit ZNF197 Polyclonal Antibody | anti-ZNF197 antibody

ZNF197 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
ZNF197; P18; VHLaK; ZNF20; ZNF166; ZKSCAN9; ZSCAN41; D3S1363E
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ZNF197, Antibody; ZNF197 antibody - N-terminal region; anti-ZNF197 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MTRENVAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRY
Sequence Length
267
Applicable Applications for anti-ZNF197 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Pig: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF197
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ZNF197 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

product-image-AAA198404_WB13.jpg WB (Western Blot) (WB Suggested Anti-ZNF197 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

IHC (Immunohistochemistry)

(Human Muscle)

product-image-AAA198404_IHC15.jpg IHC (Immunohistochemistry) (Human Muscle)
Related Product Information for anti-ZNF197 antibody
This is a rabbit polyclonal antibody against ZNF197. It was validated on Western Blot and immunohistochemistry

Target Description: ZNF197 belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas.This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene is located in a cluster of zinc finger genes at 3p21. Two alternatively spliced transcripts encoding different isoforms have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
zinc finger protein 197 isoform 2
NCBI Official Synonym Full Names
zinc finger protein 197
NCBI Official Symbol
ZNF197
NCBI Official Synonym Symbols
P18; VHLaK; ZNF20; ZNF166; ZKSCAN9; ZSCAN41; D3S1363E
NCBI Protein Information
zinc finger protein 197

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ZNF197 (Catalog #AAA198404) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF197 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF197 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ZNF197 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MTRENVAHNA LRQEGLVKGK DDTWKWGTSF QGSSSSVWET SHLHFRQLRY. It is sometimes possible for the material contained within the vial of "ZNF197, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.