Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282310_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat testis using ZNF213 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

Rabbit ZNF213 Polyclonal Antibody | anti-ZNF213 antibody

ZNF213 Rabbit pAb

Gene Names
RAB8A; MEL; RAB8
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
ZNF213, Antibody; ZNF213 Rabbit pAb; CR53; ZSCAN53; ZKSCAN21; anti-ZNF213 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
ALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
Applicable Applications for anti-ZNF213 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 132-459 of human ZNF213 (NP_004211.1).
Cellular Location
nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat testis using ZNF213 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282310_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat testis using ZNF213 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded mouse brain using ZNF213 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282310_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse brain using ZNF213 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human lung cancer using ZNF213 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282310_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human lung cancer using ZNF213 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon carcinoma using ZNF213 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282310_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon carcinoma using ZNF213 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)
Related Product Information for anti-ZNF213 antibody
C2H2 zinc finger proteins, such as ZNF213, have bipartite structures in which one domain binds DNA or RNA and the other modulates target gene expression.
Product Categories/Family for anti-ZNF213 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
207
NCBI Official Full Name
Ras-related protein Rab-8A
NCBI Official Synonym Full Names
RAB8A, member RAS oncogene family
NCBI Official Symbol
RAB8A
NCBI Official Synonym Symbols
MEL; RAB8
NCBI Protein Information
ras-related protein Rab-8A; oncogene c-mel; ras-associated protein RAB8; mel transforming oncogene (RAB8 homolog); mel transforming oncogene (derived from cell line NK14); mel transforming oncogene (derived from cell line NK14)- RAB8 homolog
UniProt Protein Name
Ras-related protein Rab-8A
UniProt Gene Name
RAB8A
UniProt Synonym Gene Names
MEL; RAB8
UniProt Entry Name
RAB8A_HUMAN

Similar Products

Product Notes

The ZNF213 rab8a (Catalog #AAA282310) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF213 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF213 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ZNF213 rab8a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ALDYGIKFME TSAKANINVE NAFFTLARDI KAKMDKKLEG NSPQGSNQGV KITPDQQKRS SFFRCVLL. It is sometimes possible for the material contained within the vial of "ZNF213, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.