Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198533_WB13.jpg WB (Western Blot) (WB Suggested Anti-ZNF274 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateZNF274 is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit anti-Human ZNF274 Polyclonal Antibody | anti-ZNF274 antibody

ZNF274 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ZNF274; ZF2; HFB101; ZSCAN51; ZKSCAN19
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ZNF274, Antibody; ZNF274 antibody - middle region; anti-ZNF274 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SHLIRHQRTHTGERPYACNKCGKAFTQSSHLIGHQRTHNRTKRKKKQPTS
Sequence Length
548
Applicable Applications for anti-ZNF274 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZNF274
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ZNF274 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateZNF274 is supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA198533_WB13.jpg WB (Western Blot) (WB Suggested Anti-ZNF274 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysateZNF274 is supported by BioGPS gene expression data to be expressed in MCF7)

IHC (Immunohistochemistry)

(Rabbit Anti-ZNF274 antibodyParaffin Embedded Tissue: Human Lungcell Cellular Data: alveolar cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198533_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-ZNF274 antibodyParaffin Embedded Tissue: Human Lungcell Cellular Data: alveolar cellAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-ZNF274 antibody
This is a rabbit polyclonal antibody against ZNF274. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZNF274 is a zinc finger protein containing five C2H2-type zinc finger domains, one or two Kruppel-associated box A (KRAB A) domains, and a leucine-rich domain. The protein has been suggested to be a transcriptional repressor. It localizes predominantly to the nucleolus. This gene encodes a zinc finger protein containing five C2H2-type zinc finger domains, one or two Kruppel-associated box A (KRAB A) domains, and a leucine-rich domain. The encoded protein has been suggested to be a transcriptional repressor. It localizes predominantly to the nucleolus. Alternatively spliced transcript variants encoding different isoforms exist. These variants utilize alternative polyadenylation signals.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
neurotrophin receptor-interacting factor homolog isoform b
NCBI Official Synonym Full Names
zinc finger protein 274
NCBI Official Symbol
ZNF274
NCBI Official Synonym Symbols
ZF2; HFB101; ZSCAN51; ZKSCAN19
NCBI Protein Information
neurotrophin receptor-interacting factor homolog
UniProt Protein Name
Neurotrophin receptor-interacting factor homolog
UniProt Gene Name
ZNF274
UniProt Synonym Gene Names
ZKSCAN19; SP2114; Zf2
UniProt Entry Name
ZN274_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ZNF274 znf274 (Catalog #AAA198533) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF274 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF274 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ZNF274 znf274 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SHLIRHQRTH TGERPYACNK CGKAFTQSSH LIGHQRTHNR TKRKKKQPTS. It is sometimes possible for the material contained within the vial of "ZNF274, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.