Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197320_WB11.jpg WB (Western Blot) (WB Suggested Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2)

Rabbit ZNF365 Polyclonal Antibody | anti-ZNF365 antibody

ZNF365 antibody - N-terminal region

Gene Names
ZNF365; UAN; Su48; ZNF365D
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
ZNF365, Antibody; ZNF365 antibody - N-terminal region; anti-ZNF365 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLFPSLKDTDLVTSSELLKP
Sequence Length
333
Applicable Applications for anti-ZNF365 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF365
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2)

product-image-AAA197320_WB11.jpg WB (Western Blot) (WB Suggested Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2)

WB (Western Blot)

(Sample Type: Human HepG2WB Suggested Anti-ZNF365 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

product-image-AAA197320_WB13.jpg WB (Western Blot) (Sample Type: Human HepG2WB Suggested Anti-ZNF365 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

IHC (Immunohistochemistry)

(Rabbit Anti-ZNF365 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HepatocyteAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197320_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-ZNF365 AntibodyParaffin Embedded Tissue: Human LiverCellular Data: HepatocyteAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-ZNF365 antibody
This is a rabbit polyclonal antibody against ZNF365. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZNF365 is located on chromosome 10.
Product Categories/Family for anti-ZNF365 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
protein ZNF365 isoform B
NCBI Official Synonym Full Names
zinc finger protein 365
NCBI Official Symbol
ZNF365
NCBI Official Synonym Symbols
UAN; Su48; ZNF365D
NCBI Protein Information
protein ZNF365

Similar Products

Product Notes

The ZNF365 (Catalog #AAA197320) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF365 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF365 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ZNF365 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DHTRFRSLSS LRAHLEFSHS YEERTLLTKC SLFPSLKDTD LVTSSELLKP. It is sometimes possible for the material contained within the vial of "ZNF365, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.