Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200170_WB15.jpg WB (Western Blot) (WB Suggested Anti-ZNF526 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Rabbit ZNF526 Polyclonal Antibody | anti-ZNF526 antibody

ZNF526 antibody - C-terminal region

Reactivity
Tested: Human
Predicted: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF526, Antibody; ZNF526 antibody - C-terminal region; anti-ZNF526 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human
Predicted: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: DCGKRFTQSSNLQQHRRLHLRPVAFARAPRLPITGLYNKSPYYCGTCGRW
Sequence Length
670
Applicable Applications for anti-ZNF526 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF526
Protein Size (#AA)
670 amino acids
Blocking Peptide
For anti-ZNF526 (MBS3210380) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degrees C up to 1 week. For long term storage, store at -20 degrees C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ZNF526 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

product-image-AAA200170_WB15.jpg WB (Western Blot) (WB Suggested Anti-ZNF526 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Related Product Information for anti-ZNF526 antibody
This is a rabbit polyclonal antibody against ZNF526. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ZNF526 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 13 C2H2-type zinc fingers. ZNF526 may be involved in transcriptional regulation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
zinc finger protein 526
NCBI Official Synonym Full Names
zinc finger protein 526
NCBI Official Symbol
ZNF526
NCBI Protein Information
zinc finger protein 526
UniProt Protein Name
Zinc finger protein 526
UniProt Gene Name
ZNF526
UniProt Synonym Gene Names
KIAA1951
UniProt Entry Name
ZN526_HUMAN

Similar Products

Product Notes

The ZNF526 znf526 (Catalog #AAA200170) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF526 antibody - C-terminal region reacts with Tested: Human Predicted: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF526 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ZNF526 znf526 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DCGKRFTQSS NLQQHRRLHL RPVAFARAPR LPITGLYNKS PYYCGTCGRW. It is sometimes possible for the material contained within the vial of "ZNF526, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.