Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281608_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat lung using ZNRF3 antibody at dilution of 1:100 (40x lens).)

Rabbit ZNRF3 Polyclonal Antibody | anti-ZNRF3 antibody

ZNRF3 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
ZNRF3; RNF203; BK747E2.3
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
ZNRF3, Antibody; ZNRF3 Rabbit pAb; ZNRF3; BK747E2.3; RNF203; anti-ZNRF3 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide,50% glycerol,pH7.3.
Sequence
MHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKV
Applicable Applications for anti-ZNRF3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ZNRF3 (NP_115549.2).
Positive Samples
A-549
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.09% Sodium azide,50% glycerol,pH7.3.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat lung using ZNRF3 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281608_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat lung using ZNRF3 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded mouse spleen using ZNRF3 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281608_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse spleen using ZNRF3 antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human liver using ZNRF3 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281608_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human liver using ZNRF3 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of A-549 cells, using at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

product-image-AAA281608_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of A-549 cells, using at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
100,574 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase ZNRF3 isoform 1
NCBI Official Synonym Full Names
zinc and ring finger 3
NCBI Official Symbol
ZNRF3
NCBI Official Synonym Symbols
RNF203; BK747E2.3
NCBI Protein Information
E3 ubiquitin-protein ligase ZNRF3; RING finger protein 203; zinc/RING finger protein 3; novel C3HC4 type Zinc finger (ring finger)
UniProt Protein Name
E3 ubiquitin-protein ligase ZNRF3
UniProt Gene Name
ZNRF3
UniProt Synonym Gene Names
KIAA1133; RNF203
UniProt Entry Name
ZNRF3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ZNRF3 znrf3 (Catalog #AAA281608) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNRF3 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNRF3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ZNRF3 znrf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MHPLGLCNNN DEEDLYEYGW VGVVKLEQPE LDPKPCLTVL GKAKRAVQRG ATAVIFDVSE NPEAIDQLNQ GSEDPLKRPV VYVKGADAIK LMNIVNKQKV. It is sometimes possible for the material contained within the vial of "ZNRF3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.