Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197797_WB8.jpg WB (Western Blot) (WB Suggested Anti-ZYX antibody Titration: 1 ug/mLSample Type: Human heart)

Rabbit ZYX Polyclonal Antibody | anti-ZYX antibody

ZYX antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ZYX; ESP-2; HED-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ZYX, Antibody; ZYX antibody - middle region; anti-ZYX antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPE
Sequence Length
572
Applicable Applications for anti-ZYX antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Rabbit: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZYX
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ZYX antibody Titration: 1 ug/mLSample Type: Human heart)

product-image-AAA197797_WB8.jpg WB (Western Blot) (WB Suggested Anti-ZYX antibody Titration: 1 ug/mLSample Type: Human heart)

WB (Western Blot)

(WB Suggested Anti-ZYX Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Stomach)

product-image-AAA197797_WB10.jpg WB (Western Blot) (WB Suggested Anti-ZYX Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Stomach)

IHC (Immunohistochemisry)

(Rabbit Anti-ZYX AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic in mitochondriaPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA197797_IHC11.jpg IHC (Immunohistochemisry) (Rabbit Anti-ZYX AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic in mitochondriaPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohiostchemistry)

(Rabbit Anti-ZYX AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA197797_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-ZYX AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult liverObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

IHC (Immunohistochemistry)

(Rabbit Anti-ZYX AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Cytoplasmic (cytoskeleton)Primary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

product-image-AAA197797_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-ZYX AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: Cytoplasmic (cytoskeleton)Primary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-ZYX antibody
This is a rabbit polyclonal antibody against ZYX. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TRIM50 is an E3 ubiquitin-protein ligase.Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin has an N-terminal proline-rich domain and three LIM domains in its C-terminal half. The proline-rich domain may interact with SH3 domains of proteins involved in signal transduction pathways while the LIM domains are likely involved in protein-protein binding. Zyxin may function as a messenger in the signal transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles. Alternative splicing results in multiple transcript variants that encode the same isoform.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
zyxin isoform 1
NCBI Official Synonym Full Names
zyxin
NCBI Official Symbol
ZYX
NCBI Official Synonym Symbols
ESP-2; HED-2
NCBI Protein Information
zyxin
UniProt Protein Name
Zyxin
UniProt Gene Name
ZYX
UniProt Entry Name
ZYX_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ZYX zyx (Catalog #AAA197797) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZYX antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZYX can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ZYX zyx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QPRGPPASSP APAPKFSPVT PKFTPVASKF SPGAPGGSGS QPNQKLGHPE. It is sometimes possible for the material contained within the vial of "ZYX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.