Pro-opiomelanocortin (POMC) Recombinant Protein | POMC recombinant protein
Recombinant Pig Pro-opiomelanocortin (POMC)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pro-opiomelanocortin (POMC); N/A; Recombinant Pig Pro-opiomelanocortin (POMC); Pro-opiomelanocortin; POMC; Corticotropin-lipotropinCleaved into the following 10 chains:; 1. NPP; 2. Melanotropin gamma; Gamma-MSH; Corticotropin; Adrenocorticotropic hormone; ACTH; Melanotropin alpha; Alpha-MSH; Corticotropin-like intermediary peptide;; POMC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-106. partial protein;
Sequence
WCLESSQCQDLSTESNLLACIRACKPDLSAETPVFPGNGDAQPLTENPRKYVMGHFRWDRFGRRNGSSSGGGGGGGGAGQ
Sequence Length
106
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for POMC recombinant protein
This gene encodes a polypeptide hormone precursor that undergoes extensive, tissue-specific, post-translational processing via cleavage by subtilisin-like enzymes known as prohormone convertases. There are eight potential cleavage sites within the polypeptide precursor and, depending on tissue type and the available convertases, processing may yield as many as ten biologically active peptides involved in diverse cellular functions. The encoded protein is synthesized mainly in corticotroph cells of the anterior pituitary where four cleavage sites are used; adrenocorticotrophin, essential for normal steroidogenesis and the maintenance of normal adrenal weight, and lipotropin beta are the major end products. In other tissues, including the hypothalamus, placenta, and epithelium, all cleavage sites may be used, giving rise to peptides with roles in pain and energy homeostasis, melanocyte stimulation, and immune modulation. These include several distinct melanotropins, lipotropins, and endorphins that are contained within the adrenocorticotrophin and beta-lipotropin peptides. Mutations in this gene have been associated with early onset obesity, adrenal insufficiency, and red hair pigmentation. Alternatively spliced transcript variants encoding the same protein have been described.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28,895 Da
NCBI Official Full Name
pro-opiomelanocortin
NCBI Official Symbol
POMC
NCBI Protein Information
pro-opiomelanocortin; corticotropin-lipotropin; proopiomelanocortin (adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin)
UniProt Protein Name
Pro-opiomelanocortin
UniProt Gene Name
POMC
UniProt Synonym Gene Names
POMC; ACTH; CLIP
UniProt Entry Name
COLI_PIG
Similar Products
Product Notes
The POMC pomc (Catalog #AAA114720) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-106. partial protein;. The amino acid sequence is listed below: WCLESSQCQD LSTESNLLAC IRACKPDLSA ETPVFPGNGD AQPLTENPRK YVMGHFRWDR FGRRNGSSSG GGGGGGGAGQ. It is sometimes possible for the material contained within the vial of "Pro-opiomelanocortin (POMC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.