Serum paraoxonase/lactonase 3 (Pon3) Recombinant Protein | Pon3 recombinant protein
Recombinant Rat Serum paraoxonase/lactonase 3 (Pon3)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Serum paraoxonase/lactonase 3 (Pon3); N/A; Recombinant Rat Serum paraoxonase/lactonase 3 (Pon3); Pon3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-354, full length protein
Sequence
GKLVALTVLGASLALLGERLLNFRERVSTSREIKPTEPQNCHLIEGLENGSEDIDILPSGLAFISTGLKYPGMPSFAPDKPGRIFLMDLNEPYPKAQALEISDGFDQDSLNPHGISTFIDKDNTVYLYAVNHPHMDSTVEIFKFEEQPRSLVHLKTIKHELFESVNDIVVLGPEQFYATRDHYFTSHFLVLLEMILDPHWTSVLFYSPKEVKVVAQGFSSANGITVSLDQKYVYVADVTAKNIHIMKKHNNWDLTPVKVIQLGTLVDNLTVDPATGDILAGCHPNPMKLLIYNPEDPPGSEVLRIQDPLSDNPRVSTLYSNNGSVLQGSTVASVYHKKMLIGTIFHKALYCEL
Sequence Length
353
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Pon3 recombinant protein
This gene is a member of the paraoxonase family and lies in a cluster on chromosome 7 with the other two family members. The encoded protein is secreted into the bloodstream and associates with high-density lipoprotein (HDL). The protein also rapidly hydrolyzes lactones and can inhibit the oxidation of low-density lipoprotein (LDL), a function that is believed to slow the initiation and progression of atherosclerosis. Alternatively spliced variants which encode different protein isoforms have been described; however, only one has been fully characterized.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,458 Da
NCBI Official Full Name
serum paraoxonase/lactonase 3
NCBI Official Synonym Full Names
paraoxonase 3
NCBI Official Symbol
Pon3
NCBI Protein Information
serum paraoxonase/lactonase 3
UniProt Protein Name
Serum paraoxonase/lactonase 3
UniProt Gene Name
Pon3
Similar Products
Product Notes
The Pon3 pon3 (Catalog #AAA116574) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-354, full length protein. The amino acid sequence is listed below: GKLVALTVLG ASLALLGERL LNFRERVSTS REIKPTEPQN CHLIEGLENG SEDIDILPSG LAFISTGLKY PGMPSFAPDK PGRIFLMDLN EPYPKAQALE ISDGFDQDSL NPHGISTFID KDNTVYLYAV NHPHMDSTVE IFKFEEQPRS LVHLKTIKHE LFESVNDIVV LGPEQFYATR DHYFTSHFLV LLEMILDPHW TSVLFYSPKE VKVVAQGFSS ANGITVSLDQ KYVYVADVTA KNIHIMKKHN NWDLTPVKVI QLGTLVDNLT VDPATGDILA GCHPNPMKLL IYNPEDPPGS EVLRIQDPLS DNPRVSTLYS NNGSVLQGST VASVYHKKML IGTIFHKALY CEL. It is sometimes possible for the material contained within the vial of "Serum paraoxonase/lactonase 3 (Pon3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.