Peptidylprolyl isomerase A (PPIA) Recombinant Protein | PPIA recombinant protein
Recombinant Human Peptidylprolyl isomerase A (PPIA) Protein
Gene Names
PPIA; CYPA; CYPH; HEL-S-69p
Applications
ELISA, Western Blot
Purity
> 90 % as determined by SDS-PAGE.
Synonyms
Peptidylprolyl isomerase A (PPIA); N/A; Recombinant Human Peptidylprolyl isomerase A (PPIA) Protein; PPIase A; CYPA; Cyclophilin A; Rotamase A; PPIA; PPIA recombinant protein
Host
E Coli
Purity/Purification
> 90 % as determined by SDS-PAGE.
Form/Format
58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0, with 15% glycerol.
Concentration
0.5 mg/mL (varies by lot)
Sequence Positions
1-165
Sequence
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIA DCGQLE
Applicable Applications for PPIA recombinant protein
ELISA, WB (Western Blot)
Source
Human
Tag Information
N-terminal GST-tag.
Usage
PPIA Protein - Centrifuge the standard vial at 6000-10000rpm for 30s.
Preparation and Storage
Storage:
Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. **Avoid repeated freeze-thaw cycles.**
Stability: The recombinant protein is stable for up to 6-12 months from date of receipt at -80°C.
Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage. **Avoid repeated freeze-thaw cycles.**
Stability: The recombinant protein is stable for up to 6-12 months from date of receipt at -80°C.
Related Product Information for PPIA recombinant protein
Background: Peptidylprolyl isomerase A also known as cyclophilin A or rotamase A is an enzyme that in humans is encoded by the PPIA gene. This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerates the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Predicted MW: 44 kDa
Observed MW: 44 kDa
Observed MW: 44 kDa
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase A isoform 2
NCBI Official Synonym Full Names
peptidylprolyl isomerase A
NCBI Official Symbol
PPIA
NCBI Official Synonym Symbols
CYPA; CYPH; HEL-S-69p
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase A
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase A
UniProt Gene Name
PPIA
UniProt Synonym Gene Names
CYPA; PPIase A
UniProt Entry Name
PPIA_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The PPIA ppia (Catalog #AAA55958) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-165 with tag N-terminal GST-tag.!!Usage||PPIA Protein - Centrifuge the standard vial at 6000-10000rpm for 30s. AAA Biotech's Peptidylprolyl isomerase A (PPIA) can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the PPIA ppia for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVNPTVFFDI AVDGEPLGRV SFELFADKVP KTAENFRALS TGEKGFGYKG SCFHRIIPGF MCQGGDFTRH NGTGGKSIYG EKFEDENFIL KHTGPGILSM ANAGPNTNGS QFFICTAKTE WLDGKHVVFG KVKEGMNIVE AMERFGSRNG KTSKKITIA DCGQLE. It is sometimes possible for the material contained within the vial of "Peptidylprolyl isomerase A (PPIA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
